Gene Information

Name : Cwoe_3240 (Cwoe_3240)
Accession : YP_003395033.1
Strain : Conexibacter woesei DSM 14684
Genome accession: NC_013739
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3444836 - 3445525 bp
Length : 690 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: sfu:Sfum_2007 transcriptional regulator

DNA sequence :
ATGAGCGACTACGCCCGCCCCGCCCGCGTCCTGGTCGTCGAGGACGACGACGAGATCGCCCAGGTTCTCCAGCGCTCGCT
GCGCATGGAGGGCTACGACGTCCGCACCGCCGGCGACGGCGTCAGCGCGCTCGACGAGGCGCACTCGTTCCTGCCCGACC
TCGTGATCCTCGACCTCGGGCTGCCGAAGCTCGACGGCATCGACGTCGCCAGAACGCTGCGCAGAGGCGACGACGTGCCG
ATCCTGATGCTGACCGCGCGCGACGCGCTCGAATCGCGCGTGGAGGGCCTCGACGCCGGTGCCGACGACTACCTCGTCAA
GCCGTTCGAGCGCCAAGAGCTGCTCGCGCGGCTGCGCGCGCTGCTGCGGCGGCGCCCGCCGCGCGGCTCGGCGCCGCTCG
TCGTCGGCGACCTGCGGCTCAACCCGGACACGCACGAGGTGCACCGCGGCGAGCGCTCGATCGAGCTGACGCAGCGCGAG
TTCGAGCTGCTGGAGTACCTGATGCGCAACGAGCGGATCGTGATCTCCCGGCAGCGGCTGCTCGACGAGGTGTGGGGCTA
CGACCCCTTCTCCACGACGAACACGATCGAGGTGTTCGTCTCGAACCTGCGACGGAAGCTGGAAGCGGACGGTGAGCCTC
GACTCCTCCATACGATCCGCGGCGCAGGCTACGTACTCCGCGTACCGTAG

Protein sequence :
MSDYARPARVLVVEDDDEIAQVLQRSLRMEGYDVRTAGDGVSALDEAHSFLPDLVILDLGLPKLDGIDVARTLRRGDDVP
ILMLTARDALESRVEGLDAGADDYLVKPFERQELLARLRALLRRRPPRGSAPLVVGDLRLNPDTHEVHRGERSIELTQRE
FELLEYLMRNERIVISRQRLLDEVWGYDPFSTTNTIEVFVSNLRRKLEADGEPRLLHTIRGAGYVLRVP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-25 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 8e-25 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cwoe_3240 YP_003395033.1 two component transcriptional regulator BAC0083 Protein 3e-30 46
Cwoe_3240 YP_003395033.1 two component transcriptional regulator AE000516.2.gene3505. Protein 1e-35 46
Cwoe_3240 YP_003395033.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 7e-34 44
Cwoe_3240 YP_003395033.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 7e-34 44
Cwoe_3240 YP_003395033.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 7e-34 44
Cwoe_3240 YP_003395033.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 7e-34 44
Cwoe_3240 YP_003395033.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 7e-34 44
Cwoe_3240 YP_003395033.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 7e-34 44
Cwoe_3240 YP_003395033.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 7e-34 44
Cwoe_3240 YP_003395033.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 7e-34 44
Cwoe_3240 YP_003395033.1 two component transcriptional regulator BAC0638 Protein 2e-21 44
Cwoe_3240 YP_003395033.1 two component transcriptional regulator HE999704.1.gene1528. Protein 2e-34 43
Cwoe_3240 YP_003395033.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 1e-33 43
Cwoe_3240 YP_003395033.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-33 43
Cwoe_3240 YP_003395033.1 two component transcriptional regulator BAC0125 Protein 9e-29 43
Cwoe_3240 YP_003395033.1 two component transcriptional regulator BAC0111 Protein 8e-30 42
Cwoe_3240 YP_003395033.1 two component transcriptional regulator BAC0308 Protein 1e-28 42
Cwoe_3240 YP_003395033.1 two component transcriptional regulator NC_002516.2.879194.p Protein 4e-28 42
Cwoe_3240 YP_003395033.1 two component transcriptional regulator Y16952.3.orf35.gene. Protein 4e-27 42
Cwoe_3240 YP_003395033.1 two component transcriptional regulator BAC0197 Protein 3e-28 42
Cwoe_3240 YP_003395033.1 two component transcriptional regulator NC_002695.1.915041.p Protein 5e-19 41
Cwoe_3240 YP_003395033.1 two component transcriptional regulator CP000034.1.gene3834. Protein 5e-19 41
Cwoe_3240 YP_003395033.1 two component transcriptional regulator BAC0347 Protein 6e-27 41
Cwoe_3240 YP_003395033.1 two component transcriptional regulator U82965.2.orf14.gene. Protein 5e-26 41
Cwoe_3240 YP_003395033.1 two component transcriptional regulator HE999704.1.gene2815. Protein 1e-32 41
Cwoe_3240 YP_003395033.1 two component transcriptional regulator CP001918.1.gene5135. Protein 2e-15 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cwoe_3240 YP_003395033.1 two component transcriptional regulator VFG1390 Protein 1e-45 57
Cwoe_3240 YP_003395033.1 two component transcriptional regulator VFG1386 Protein 1e-37 47
Cwoe_3240 YP_003395033.1 two component transcriptional regulator VFG1389 Protein 5e-38 46
Cwoe_3240 YP_003395033.1 two component transcriptional regulator VFG0473 Protein 5e-24 42
Cwoe_3240 YP_003395033.1 two component transcriptional regulator VFG0596 Protein 1e-25 41