Gene Information

Name : Cwoe_4508 (Cwoe_4508)
Accession : YP_003396296.1
Strain : Conexibacter woesei DSM 14684
Genome accession: NC_013739
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4808609 - 4809304 bp
Length : 696 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: geo:Geob_0409 transcriptional regulator

DNA sequence :
ATGAGCGAACAGGCCCACCGCGTCCTCGTCGTCGACGACGAGCCGAACATCGTGGACGTGATCTCGATGGCGCTCCGCTA
CCAGGGCTTCGAGGTGGCCTCGGCGTCGAGCGGCGCCGAGGCCCTCGCGCAGGTGCGGCAGTTCCGCCCCCATCTGCTGC
TGCTCGACGTGATGCTGCCCGACATGGAGGGGTTCGAGGTCGCCAGACGGCTCGGCGCCGAGCGCGCCCGCGTCCCGATC
GTCTTCCTCACCGCCCGCGACGCGACCGACGACAGAGTGCGCGGGCTGACGCTCGGCGGCGACGACTACGTCACGAAGCC
GTTCAGCCTCGAGGAGCTGGTCGCGCGGATCCGCACGATCCTGCGCCGCACCGGGATGGCCGAGCCGGAGTCGAGCAGAC
TCGTCTTCGACGACCTCGAGCTGGACGAGGACACGCGCGAGGTGACGCGCGCCGGCGCCTACGTCGAGCTGACCGCGACC
GAGTACCGCCTGCTGCGCTACCTGATGCTCAACCCCCGTCGCGTGCTGACGCGCGCGCAGCTGCTGGAGCACGTCTGGAG
CTACGACTTCGGCGGCGACGCGCGCGTGCTGGAGACCTACGTCAGCTACGTGCGCAAGAAGCTCGACGCCCACGGCCCGC
CACTGATCCAGACGGTTCGCGGCGTCGGCTACGCGCTGCGGCTCCCGCGCGCGTGA

Protein sequence :
MSEQAHRVLVVDDEPNIVDVISMALRYQGFEVASASSGAEALAQVRQFRPHLLLLDVMLPDMEGFEVARRLGAERARVPI
VFLTARDATDDRVRGLTLGGDDYVTKPFSLEELVARIRTILRRTGMAEPESSRLVFDDLELDEDTREVTRAGAYVELTAT
EYRLLRYLMLNPRRVLTRAQLLEHVWSYDFGGDARVLETYVSYVRKKLDAHGPPLIQTVRGVGYALRLPRA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
CDB402_0209 YP_005126722.1 two-component system response regulator Not tested Not named Protein 2e-33 41
mprA YP_005680459.1 response regulator mprA Not tested PiCp 3 Protein 1e-33 41
mprA YP_005682550.1 response regulator mprA Not tested PiCp 3 Protein 1e-33 41
tcsR1 YP_003782583.1 two-component system transcriptional regulatory protein Not tested PiCp 3 Protein 1e-33 41
mprA YP_005684640.1 response regulator mprA Not tested PiCp 3 Protein 1e-33 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cwoe_4508 YP_003396296.1 two component transcriptional regulator BAC0197 Protein 2e-36 44
Cwoe_4508 YP_003396296.1 two component transcriptional regulator AE000516.2.gene3505. Protein 4e-38 44
Cwoe_4508 YP_003396296.1 two component transcriptional regulator BAC0083 Protein 7e-39 43
Cwoe_4508 YP_003396296.1 two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-41 42
Cwoe_4508 YP_003396296.1 two component transcriptional regulator NC_013450.8614421.p0 Protein 3e-41 42
Cwoe_4508 YP_003396296.1 two component transcriptional regulator NC_007793.3914279.p0 Protein 3e-41 42
Cwoe_4508 YP_003396296.1 two component transcriptional regulator NC_007622.3794472.p0 Protein 2e-41 42
Cwoe_4508 YP_003396296.1 two component transcriptional regulator NC_002745.1124361.p0 Protein 3e-41 42
Cwoe_4508 YP_003396296.1 two component transcriptional regulator NC_009782.5559369.p0 Protein 3e-41 42
Cwoe_4508 YP_003396296.1 two component transcriptional regulator NC_002951.3237708.p0 Protein 3e-41 42
Cwoe_4508 YP_003396296.1 two component transcriptional regulator NC_003923.1003749.p0 Protein 3e-41 42
Cwoe_4508 YP_003396296.1 two component transcriptional regulator NC_002758.1121668.p0 Protein 3e-41 42
Cwoe_4508 YP_003396296.1 two component transcriptional regulator NC_009641.5332272.p0 Protein 3e-41 42
Cwoe_4508 YP_003396296.1 two component transcriptional regulator BAC0638 Protein 5e-33 42
Cwoe_4508 YP_003396296.1 two component transcriptional regulator HE999704.1.gene1528. Protein 6e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cwoe_4508 YP_003396296.1 two component transcriptional regulator VFG1386 Protein 4e-64 57
Cwoe_4508 YP_003396296.1 two component transcriptional regulator VFG1390 Protein 1e-49 50
Cwoe_4508 YP_003396296.1 two component transcriptional regulator VFG1389 Protein 4e-41 46