Gene Information

Name : Acfer_0098 (Acfer_0098)
Accession : YP_003397822.1
Strain : Acidaminococcus fermentans DSM 20731
Genome accession: NC_013740
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 119931 - 120605 bp
Length : 675 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: bcg:BCG9842_B2033 DNA-binding response regulator

DNA sequence :
ATGAAAATCCTGGTGGTGGAAGATGAACCCACGCTGAATAAAATCATTGCCAAACGGCTGAAAATCGAAGCTTATTCGGT
GGACTGCGCTTTTAACGGAAAGGAAGCACTGGACTATCTGGATGCGGCGGAATATGATCTGCTGATCGTGGATATCATGA
TGCCGGAAATGGACGGACTGACCCTTGTGAAAAAGCTCCGGGACGGAGGCAGCCGGGTGCCGGTCCTGTTCCTGACGGCC
CTGGACAGCACCCAGGACAAGGTCACCGGCCTGGACAGCGGCGGGGACGATTATCTGGTAAAGCCCTTTGAATTCGATGA
ACTGCTGGCCCGGATCCGCAGCCTGCTCCGGCGGAGCAATGCCCAGCAGACCGCCCGGACCCGGCTGACCCTGGCGGATC
TGACCCTGGACACCCGGACCCATCAGGTGACCCGGGGCGGGCAGGAAATTGCCCTGACCCCCAAGGAATTCTCCGTGCTG
GATTATCTCCTGCGGAACCAGGGAACGGTGCTTTCCCGGGAACAGATCCTGGAACATGCCTGGGATTTTTCTTATGAAGG
ATATTCCAATATGGTGGATGTGTACATCAAGACCCTGCGGAAGAAAATCGACAGGGATTTTGAACCCAAGCTGCTCCACA
CGGTACGGGGGACCGGCTATGTGCTCAAAGTGTAG

Protein sequence :
MKILVVEDEPTLNKIIAKRLKIEAYSVDCAFNGKEALDYLDAAEYDLLIVDIMMPEMDGLTLVKKLRDGGSRVPVLFLTA
LDSTQDKVTGLDSGGDDYLVKPFEFDELLARIRSLLRRSNAQQTARTRLTLADLTLDTRTHQVTRGGQEIALTPKEFSVL
DYLLRNQGTVLSREQILEHAWDFSYEGYSNMVDVYIKTLRKKIDRDFEPKLLHTVRGTGYVLKV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 6e-26 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-25 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Acfer_0098 YP_003397822.1 two component transcriptional regulator, winged helix family BAC0125 Protein 5e-33 47
Acfer_0098 YP_003397822.1 two component transcriptional regulator, winged helix family BAC0111 Protein 1e-35 47
Acfer_0098 YP_003397822.1 two component transcriptional regulator, winged helix family BAC0083 Protein 1e-36 47
Acfer_0098 YP_003397822.1 two component transcriptional regulator, winged helix family BAC0638 Protein 2e-28 47
Acfer_0098 YP_003397822.1 two component transcriptional regulator, winged helix family BAC0347 Protein 9e-30 46
Acfer_0098 YP_003397822.1 two component transcriptional regulator, winged helix family BAC0197 Protein 2e-31 46
Acfer_0098 YP_003397822.1 two component transcriptional regulator, winged helix family BAC0308 Protein 4e-33 44
Acfer_0098 YP_003397822.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 8e-27 43
Acfer_0098 YP_003397822.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 8e-27 43
Acfer_0098 YP_003397822.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 8e-27 43
Acfer_0098 YP_003397822.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 8e-27 43
Acfer_0098 YP_003397822.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 8e-27 43
Acfer_0098 YP_003397822.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 8e-27 43
Acfer_0098 YP_003397822.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 8e-27 43
Acfer_0098 YP_003397822.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 8e-27 43
Acfer_0098 YP_003397822.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 5e-22 42
Acfer_0098 YP_003397822.1 two component transcriptional regulator, winged helix family BAC0288 Protein 9e-21 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Acfer_0098 YP_003397822.1 two component transcriptional regulator, winged helix family VFG1390 Protein 5e-36 46
Acfer_0098 YP_003397822.1 two component transcriptional regulator, winged helix family VFG1386 Protein 1e-35 44
Acfer_0098 YP_003397822.1 two component transcriptional regulator, winged helix family VFG0596 Protein 2e-26 42
Acfer_0098 YP_003397822.1 two component transcriptional regulator, winged helix family VFG0473 Protein 1e-20 41