Gene Information

Name : Gobs_1203 (Gobs_1203)
Accession : YP_003408322.1
Strain : Geodermatophilus obscurus DSM 43160
Genome accession: NC_013757
Putative virulence/resistance : Unknown
Product : transposase IS3/IS911 family protein
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 1264902 - 1265231 bp
Length : 330 bp
Strand : +
Note : PFAM: transposase IS3/IS911 family protein; KEGG: mbt:JTY_2827 putative transposase

DNA sequence :
ATGGCAGGACGCCACGGGCAGTACCCACCGGAGTTGCGGGAGCGGGCGGTGCGGCTGGTCGCCGAGTGCCGCGCCGATCA
CGACTCGGAGTGGGACGCGATGCGCTCGGTCGCCCAGAAGCTGGGCATCGGTACCACCGAGACGGTGCGCAAGTGGGTCC
GCCGGGCCGAGGTCGACGCCGGGGCCCGCCCAGGCGTGACCAGCGAGGAATCCGCGGAGCTGCGCCGGCTGAAGGCCGAG
GTCAAAGAATTGCGCCGGGCCAATGAGATCCTCAGGGCGGCGGCGGGTTTCTTCGCGGCCGAGCTCGACCGGCCACACCG
GAGCTTGTGA

Protein sequence :
MAGRHGQYPPELRERAVRLVAECRADHDSEWDAMRSVAQKLGIGTTETVRKWVRRAEVDAGARPGVTSEESAELRRLKAE
VKELRRANEILRAAAGFFAAELDRPHRSL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
Z1222 NP_286757.1 hypothetical protein Not tested TAI Protein 1e-15 47
ECO111_3720 YP_003236060.1 putative IS629 transposase OrfA Not tested LEE Protein 4e-14 47
Z1639 NP_287142.1 hypothetical protein Not tested TAI Protein 1e-15 47
ECO111_3775 YP_003236110.1 putative IS629 transposase OrfA Not tested LEE Protein 4e-14 47
Z1661 NP_287163.1 hypothetical protein Not tested TAI Protein 1e-15 47
Z4335 NP_289560.1 hypothetical protein Not tested OI-122 Protein 4e-14 47
Z1199 NP_286734.1 hypothetical protein Not tested TAI Protein 1e-15 47
IS629 CAC37925.1 hypothetical protein Not tested LEE Protein 1e-15 46
IS629 CAI43820.1 hypothetical protein Not tested LEE Protein 1e-15 46
IS629 CAI43841.1 hypothetical protein Not tested LEE Protein 1e-15 46
IS629 CAI43908.1 hypothetical protein 1 Not tested LEE Protein 1e-15 46
unnamed CAD42084.1 hypothetical protein Not tested PAI II 536 Protein 3e-12 46
ECO103_3584 YP_003223442.1 IS629 transposase OrfA Not tested LEE Protein 2e-15 46
SF2979 NP_708753.1 IS629 ORF1 Not tested SHI-1 Protein 6e-13 45
tnpE AAD44738.1 TnpE Not tested SHI-2 Protein 5e-13 45
unnamed AAL67399.1 TnpE-like protein Not tested PAI II CFT073 Protein 4e-13 45
unnamed ADD91740.1 hypothetical protein Not tested PAI-I AL862 Protein 4e-13 45
APECO1_3498 YP_854313.1 transposase; OrfA protein of insertion sequence IS629 Not tested PAI I APEC-O1 Protein 2e-11 45
c5168 NP_757016.1 hypothetical protein Not tested PAI II CFT073 Protein 6e-13 45
ORF_36 AAZ04445.1 conserved hypothetical protein Not tested PAI I APEC-O1 Protein 1e-11 45
c5214 NP_757062.1 hypothetical protein Not tested PAI II CFT073 Protein 6e-13 45
S3184 NP_838467.1 IS629 orfA Not tested SHI-1 Protein 6e-13 45
unnamed AAF09023.1 unknown Not tested SHI-O Protein 5e-13 45
c5177 NP_757025.1 hypothetical protein Not tested PAI II CFT073 Protein 9e-11 44
ECUMN_3344 YP_002414020.1 transposase ORF A, IS629 Not tested Not named Protein 9e-11 44
S4062 NP_839231.1 IS629 orfA Not tested SHI-2 Protein 2e-11 44
r13 AAC61722.1 R13 Not tested PAI I CFT073 Protein 6e-11 44
unnamed AAL67404.1 R13-like protein Not tested PAI II CFT073 Protein 6e-11 44
c3596 NP_755471.1 hypothetical protein Not tested PAI I CFT073 Protein 9e-11 44
CDC7B_2036 YP_005163477.1 hypothetical protein Not tested Not named Protein 2e-14 43
SF3706 NP_709445.1 IS629 ORF1 Not tested SHI-2 Protein 6e-12 43
CDCE8392_1959 YP_005134490.1 hypothetical protein Not tested Not named Protein 9e-15 43

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Gobs_1203 YP_003408322.1 transposase IS3/IS911 family protein VFG1603 Protein 1e-12 46
Gobs_1203 YP_003408322.1 transposase IS3/IS911 family protein VFG0643 Protein 2e-13 45
Gobs_1203 YP_003408322.1 transposase IS3/IS911 family protein VFG1717 Protein 2e-11 44
Gobs_1203 YP_003408322.1 transposase IS3/IS911 family protein VFG0606 Protein 2e-12 43