Gene Information

Name : phoP (LM5923_2645)
Accession : YP_003417848.1
Strain : Listeria monocytogenes 08-5923
Genome accession: NC_013768
Putative virulence/resistance : Virulence
Product : two-component response phosphate regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2656237 - 2656947 bp
Length : 711 bp
Strand : -
Note : -

DNA sequence :
TTGGTAAAAATTCTTGTAGTTGATGATGAAGCTTCTATTGTTACCTTGCTACAATTTAATATTGAAAAAGCAGGATTTGA
AGTGGTGACAGCTGAAGATGGTAGAACTGGGTATGAGCTCGCTTTGTCCGAAAAGCCAGATTTAATTGTGCTTGATTTAA
TGCTTCCTGAGATGGACGGAATCGAAGTAACAAAAAAACTTCGTCAAGATAAAGTAAATGTACCAATTTTAATGTTAACA
GCAAAAGATGAAGAGTTAGATAAAATTATTGGACTTGAACTTGGAGCAGATGATTATATGACTAAGCCTTTTAGTCCAAG
AGAAGTAGTGGCGAGAATTAAAGCTATCCTGCGTCGAACAGAAGGAAAAGCAGAAATAATAGAAGAATTAACCGAAGATG
TGGAAGCCGCTATATTAATTGGTGATTTGAAAATTTTGCCAGATAGTTACGAAGTGTATTTACAAGATGATTTACTTGAC
CTAACACCGAAAGAATTTGAGTTATTATTATTCCTGGCGAATCATCGTGGCAAAGTTTTCTCCAGAGACCAATTGCTCGA
TACTGTCTGGAACTATGATTACGTTGGCGAAACCCGAATTGTAGACGTTCATGTTAGCCATTTGCGCGATAAAATCGAAC
TAGATACGAAACAACCTAAATATATCAAAACAATTCGTGGCTTCGGTTATAAAATGGAGAACGTAAAATAA

Protein sequence :
MVKILVVDDEASIVTLLQFNIEKAGFEVVTAEDGRTGYELALSEKPDLIVLDLMLPEMDGIEVTKKLRQDKVNVPILMLT
AKDEELDKIIGLELGADDYMTKPFSPREVVARIKAILRRTEGKAEIIEELTEDVEAAILIGDLKILPDSYEVYLQDDLLD
LTPKEFELLLFLANHRGKVFSRDQLLDTVWNYDYVGETRIVDVHVSHLRDKIELDTKQPKYIKTIRGFGYKMENVK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-41 43
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-41 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
phoP YP_003417848.1 two-component response phosphate regulator HE999704.1.gene2815. Protein 7e-107 99
phoP YP_003417848.1 two-component response phosphate regulator NC_003923.1003749.p0 Protein 3e-68 61
phoP YP_003417848.1 two-component response phosphate regulator NC_002952.2859905.p0 Protein 4e-68 60
phoP YP_003417848.1 two-component response phosphate regulator NC_007622.3794472.p0 Protein 4e-68 60
phoP YP_003417848.1 two-component response phosphate regulator NC_002745.1124361.p0 Protein 3e-68 60
phoP YP_003417848.1 two-component response phosphate regulator NC_009782.5559369.p0 Protein 3e-68 60
phoP YP_003417848.1 two-component response phosphate regulator NC_002951.3237708.p0 Protein 3e-68 60
phoP YP_003417848.1 two-component response phosphate regulator NC_002758.1121668.p0 Protein 3e-68 60
phoP YP_003417848.1 two-component response phosphate regulator NC_009641.5332272.p0 Protein 3e-68 60
phoP YP_003417848.1 two-component response phosphate regulator NC_013450.8614421.p0 Protein 3e-68 60
phoP YP_003417848.1 two-component response phosphate regulator NC_007793.3914279.p0 Protein 3e-68 60
phoP YP_003417848.1 two-component response phosphate regulator AE016830.1.gene1681. Protein 1e-69 57
phoP YP_003417848.1 two-component response phosphate regulator NC_012469.1.7685629. Protein 3e-55 55
phoP YP_003417848.1 two-component response phosphate regulator NC_012469.1.7686381. Protein 5e-60 50
phoP YP_003417848.1 two-component response phosphate regulator CP001485.1.gene721.p Protein 2e-36 43
phoP YP_003417848.1 two-component response phosphate regulator AF162694.1.orf4.gene Protein 3e-37 43
phoP YP_003417848.1 two-component response phosphate regulator AE000516.2.gene3505. Protein 7e-38 43
phoP YP_003417848.1 two-component response phosphate regulator CP004022.1.gene3215. Protein 4e-36 41
phoP YP_003417848.1 two-component response phosphate regulator EU250284.1.orf4.gene Protein 8e-39 41
phoP YP_003417848.1 two-component response phosphate regulator CP000034.1.gene3834. Protein 2e-31 41
phoP YP_003417848.1 two-component response phosphate regulator CP001138.1.gene4273. Protein 6e-32 41
phoP YP_003417848.1 two-component response phosphate regulator BAC0533 Protein 5e-32 41
phoP YP_003417848.1 two-component response phosphate regulator NC_002695.1.915041.p Protein 2e-31 41
phoP YP_003417848.1 two-component response phosphate regulator CP000647.1.gene4257. Protein 5e-32 41
phoP YP_003417848.1 two-component response phosphate regulator AM180355.1.gene1830. Protein 5e-38 41
phoP YP_003417848.1 two-component response phosphate regulator CP001918.1.gene3444. Protein 3e-34 41
phoP YP_003417848.1 two-component response phosphate regulator CP000034.1.gene3671. Protein 5e-39 41
phoP YP_003417848.1 two-component response phosphate regulator CP001918.1.gene5135. Protein 2e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
phoP YP_003417848.1 two-component response phosphate regulator VFG1702 Protein 6e-42 43
phoP YP_003417848.1 two-component response phosphate regulator VFG1563 Protein 7e-42 42
phoP YP_003417848.1 two-component response phosphate regulator VFG1386 Protein 5e-39 42
phoP YP_003417848.1 two-component response phosphate regulator VFG1389 Protein 7e-33 41