Gene Information

Name : BpOF4_06195 (BpOF4_06195)
Accession : YP_003426193.1
Strain : Bacillus pseudofirmus OF4
Genome accession: NC_013791
Putative virulence/resistance : Resistance
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3523034 - 3523723 bp
Length : 690 bp
Strand : +
Note : COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain

DNA sequence :
ATGAAAGAGATACGAATTCTTATTGTTGAAGATGAAGCACCGATGCGTGAATTACTACAATTATATTTGAGAAAGGAAGG
ATATGTGGTAGACGAAGCAATAACCGGTATAGAGGCCCTTGAAAAAGTAGAAAAAACATTATATTCCGTTGTCTTATTGG
ATGTAATGATGCCTGAAATGGATGGGTTTGAAGTCTGTAGGGAAATACGAAAGGTTTCACAGGTCCCTGTTATAATGTTA
ACCGCACGTACGCAAACTTTAGACAAAGTAAAAGGGCTAAAGATTGGTGCTGATGATTATTTAACAAAACCTTTTGAACA
AGAAGAATTACTGGCTCGTGTTGAGGCAGTTTTACGAAGATATGGAGTAAGCGAACCCGAATCAAGAGGTAACACTTTAT
TTTTTAAAGGTCTAGTAATGAAAAGAAACGCCTATCAAGTTTATTATAACGAGGAAGAACTTTCTTTAACACCTAAAGAA
TTTGCAATTCTGGAGTTATTCTTACTAAATAAAAATCGAGTTTTTAGTCGAGATGATATTTTAGAACTAGTATGGGGCTA
TGATTTTATTGGTGATTATCGAGGTGTGGACACACACGTTAAACACTTACGTGATAAATTAACAGAAGCTGGGATATCTG
GACGTAGCGTAATCAAAACTGTATGGGGAGTGGGGTATAAGCTAGGATGA

Protein sequence :
MKEIRILIVEDEAPMRELLQLYLRKEGYVVDEAITGIEALEKVEKTLYSVVLLDVMMPEMDGFEVCREIRKVSQVPVIML
TARTQTLDKVKGLKIGADDYLTKPFEQEELLARVEAVLRRYGVSEPESRGNTLFFKGLVMKRNAYQVYYNEEELSLTPKE
FAILELFLLNKNRVFSRDDILELVWGYDFIGDYRGVDTHVKHLRDKLTEAGISGRSVIKTVWGVGYKLG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 1e-37 41
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 3e-36 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BpOF4_06195 YP_003426193.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 7e-44 45
BpOF4_06195 YP_003426193.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 9e-44 45
BpOF4_06195 YP_003426193.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 9e-44 45
BpOF4_06195 YP_003426193.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 9e-44 45
BpOF4_06195 YP_003426193.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 8e-44 45
BpOF4_06195 YP_003426193.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 9e-44 45
BpOF4_06195 YP_003426193.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 9e-44 45
BpOF4_06195 YP_003426193.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 9e-44 45
BpOF4_06195 YP_003426193.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 9e-44 45
BpOF4_06195 YP_003426193.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-43 45
BpOF4_06195 YP_003426193.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 1e-40 44
BpOF4_06195 YP_003426193.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 1e-40 44
BpOF4_06195 YP_003426193.1 winged helix family two component transcriptional regulator NC_014475.1.orf0.gen Protein 3e-41 43
BpOF4_06195 YP_003426193.1 winged helix family two component transcriptional regulator NC_005054.2598277.p0 Protein 3e-41 43
BpOF4_06195 YP_003426193.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 2e-38 43
BpOF4_06195 YP_003426193.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 7e-34 43
BpOF4_06195 YP_003426193.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 8e-41 42
BpOF4_06195 YP_003426193.1 winged helix family two component transcriptional regulator AF310956.2.orf0.gene Protein 5e-38 41
BpOF4_06195 YP_003426193.1 winged helix family two component transcriptional regulator AE016830.1.gene2255. Protein 1e-36 41
BpOF4_06195 YP_003426193.1 winged helix family two component transcriptional regulator U35369.1.gene1.p01 Protein 1e-36 41
BpOF4_06195 YP_003426193.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 5e-37 41
BpOF4_06195 YP_003426193.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 5e-37 41
BpOF4_06195 YP_003426193.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 5e-37 41
BpOF4_06195 YP_003426193.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 5e-37 41
BpOF4_06195 YP_003426193.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 5e-37 41
BpOF4_06195 YP_003426193.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 5e-37 41
BpOF4_06195 YP_003426193.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 5e-37 41
BpOF4_06195 YP_003426193.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 5e-37 41
BpOF4_06195 YP_003426193.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 1e-33 41
BpOF4_06195 YP_003426193.1 winged helix family two component transcriptional regulator DQ212986.1.gene4.p01 Protein 6e-38 41
BpOF4_06195 YP_003426193.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 3e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BpOF4_06195 YP_003426193.1 winged helix family two component transcriptional regulator VFG1390 Protein 3e-37 42
BpOF4_06195 YP_003426193.1 winged helix family two component transcriptional regulator VFG1386 Protein 2e-36 41
BpOF4_06195 YP_003426193.1 winged helix family two component transcriptional regulator VFG1389 Protein 1e-29 41