Gene Information

Name : GALLO_1584 (GALLO_1584)
Accession : YP_003430999.1
Strain : Streptococcus gallolyticus UCN34
Genome accession: NC_013798
Putative virulence/resistance : Resistance
Product : small multidrug resistance protein
Function : -
COG functional category : P : Inorganic ion transport and metabolism
COG ID : COG2076
EC number : -
Position : 1669668 - 1669994 bp
Length : 327 bp
Strand : -
Note : -

DNA sequence :
ATGTCATACTTACATCTTTTTATCGCCATTTTAGGAGAGTTATTGGGAACTAACTTATTGAAATTATCAGACGGTTTTAC
AAAGCCTATTCCAACCGTTTCTGCCCTACTTAGCTATGGCGTTTGTTTCTATTTCTTATCACTGGCAATGCGAAAAATTC
CTTTAGGAGTAACTTATGCAACATGGTCAGCTGTCGGTCTAGTTTTGACAGCCTTTATCTCAGTAATGATTTTCAAAGAA
ACACTAAATGTTTATAGCATTATCGGTTTAATTTTGATTATCATCGGTGTTGTCATGGTTAACTTATTAGGAAATGCGGG
ACATTAA

Protein sequence :
MSYLHLFIAILGELLGTNLLKLSDGFTKPIPTVSALLSYGVCFYFLSLAMRKIPLGVTYATWSAVGLVLTAFISVMIFKE
TLNVYSIIGLILIIIGVVMVNLLGNAGH

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
qacEdelta1 AFV53123.1 QacEdelta1 multidrug exporter Not tested AbGRI2-1 Protein 9e-11 42
qacEdelta1 AGF35063.1 QacEdelta1 Not tested SGI1 Protein 9e-11 42
qacEdelta1 CAJ77088.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 9e-11 42
qacEdelta1 ACN81026.1 QacEdelta1 Not tested AbaR5 Protein 1e-10 42
qacEdelta1 AGK36647.1 QacEdelta1 Not tested AbaR26 Protein 9e-11 42
qacEdelta1 AGK06933.1 QacEdelta1 Not tested SGI1 Protein 9e-11 42
qacE-deltal ACF06159.1 quartenary ammonium compound resistance protein Not tested Tn5036-like Protein 9e-11 42
qacEdelta1 AAK02047.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 9e-11 42
qacEdelta1 AGK06970.1 QacEdelta1 Not tested SGI1 Protein 9e-11 42
qacE-delta1 ACY75523.1 QacE-delta1 Not tested Tn6060 Protein 9e-11 42
qacEdelta1 AAK02056.1 quaternary ammonium compound and disinfectant protein Not tested SGI1 Protein 9e-11 42
qacEdelta1 AGK06979.1 QacEdelta1 Not tested SGI1 Protein 9e-11 42
qacE-delta1 ACY75532.1 QacE-delta1 Not tested Tn6060 Protein 9e-11 42
qacEdelta1 ABB48428.1 QacEdelta1 Not tested SGI1 Protein 9e-11 42
qacEdelta1 AGK07016.1 QacEdelta1 Not tested SGI1 Protein 9e-11 42
qacE-delta1 AET25389.1 QacE-delta1 Not tested PAGI-2(C) Protein 9e-11 42
qacEdelta1 ABZ01839.1 QacEdelta1 Not tested SGI2 Protein 9e-11 42
ACICU_00227 YP_001844886.1 membrane transporter Not tested AbaR20 Protein 1e-10 42
qacEdelta1 AGK07074.1 QacEdelta1 Not tested SGI1 Protein 9e-11 42
qacE-delta1 AFG30112.1 QacE-delta1 Not tested PAGI-2 Protein 9e-11 42
qacEdelta1 CAJ77030.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 9e-11 42
qacEdelta1 YP_005797134.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 1e-10 42
qacEdelta1 AGK07100.1 QacEdelta1 Not tested SGI1 Protein 9e-11 42
qacEdelta1 AGF34989.1 QacEdelta1 Not tested SGI1 Protein 9e-11 42
qacEdelta1 CAJ77049.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 9e-11 42
qacEdelta1 YP_005797150.1 quaternary ammonium compound-resistance protein Not tested AbaR4e Protein 1e-10 42
qacEdelta1 AGK07109.1 QacEdelta1 Not tested SGI1 Protein 9e-11 42
qacEdelta1 AGF35028.1 QacEdelta1 Not tested SGI1 Protein 9e-11 42
qacEdelta1 CAJ77052.1 Quaternary ammonium compound-resistance protein Not tested AbaR1 Protein 9e-11 42
ebr YP_006098377.1 putative ethidium bromide resistance protein Not tested Tn2411 Protein 1e-10 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GALLO_1584 YP_003430999.1 small multidrug resistance protein BAC0325 Protein 1e-17 60
GALLO_1584 YP_003430999.1 small multidrug resistance protein BAC0327 Protein 2e-16 57
GALLO_1584 YP_003430999.1 small multidrug resistance protein BAC0329 Protein 1e-14 53
GALLO_1584 YP_003430999.1 small multidrug resistance protein BAC0321 Protein 1e-16 52
GALLO_1584 YP_003430999.1 small multidrug resistance protein BAC0326 Protein 2e-15 52
GALLO_1584 YP_003430999.1 small multidrug resistance protein BAC0139 Protein 7e-11 51
GALLO_1584 YP_003430999.1 small multidrug resistance protein BAC0002 Protein 2e-12 46
GALLO_1584 YP_003430999.1 small multidrug resistance protein NC_010410.6003348.p0 Protein 2e-12 46
GALLO_1584 YP_003430999.1 small multidrug resistance protein CP001138.1.gene1489. Protein 1e-09 44
GALLO_1584 YP_003430999.1 small multidrug resistance protein BAC0322 Protein 4e-11 42
GALLO_1584 YP_003430999.1 small multidrug resistance protein BAC0323 Protein 4e-11 42