Gene Information

Name : HTH_1434 (HTH_1434)
Accession : YP_003433086.1
Strain : Hydrogenobacter thermophilus TK-6
Genome accession: NC_013799
Putative virulence/resistance : Virulence
Product : two-component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1309853 - 1310527 bp
Length : 675 bp
Strand : +
Note : -

DNA sequence :
ATGAAAGTGCTTCTCGTTGAAGATGACACTTATGTAGGAGAGATGATAAAGGAGGGGCTTACTTACGAAGGTTACCATGT
GGTTTGGGTAAGGGATGGTTTTTCCGCCATGAGGGAAGCCTTAGAAGGCGACTACCATCTTATTCTTCTTGATATCATGC
TGCCCAAGTTTGATGGCATGAAGGTACTAAGCAGGATAAGGGAGGTAAAGGATATTCCTGTTATTATGATCACCGCAAAG
TCTCAGGTGGAAGATAAAGTGGAAGGACTTTCCGCAGGCGCGGATGATTACATAACCAAGCCTTTTTCCTTCAAGGAGGT
GCTGGCAAGAATAAATGCAGTGCTAAGAAGGTATAAAAAAGAAGAGGAGGACATTATAAAAGTAGGTGATCTTCTGATAA
ACCCGAGGTCTTACGAGGTGTATTACAGAGGGCGCAGTATAAAACTGACCAGCAGGGAGTTTAAACTCCTCAAAGTGCTT
GCAGAACATGCAGGAGAGGTCTTAAGCAGGGAAAGACTCTTTGCAAAGGTTTGGGGATCCTCTTACGGTGAAAATTCCAA
TGTGGTGGATGTTTACATAAAAAACCTAAGGAATAAGCTGGAGGATAGACCTCCAAAACTTATTCATACTGTCAGGGGAA
TGGGCTACATGTTAAAACCACAAGATGTCAGTTAA

Protein sequence :
MKVLLVEDDTYVGEMIKEGLTYEGYHVVWVRDGFSAMREALEGDYHLILLDIMLPKFDGMKVLSRIREVKDIPVIMITAK
SQVEDKVEGLSAGADDYITKPFSFKEVLARINAVLRRYKKEEEDIIKVGDLLINPRSYEVYYRGRSIKLTSREFKLLKVL
AEHAGEVLSRERLFAKVWGSSYGENSNVVDVYIKNLRNKLEDRPPKLIHTVRGMGYMLKPQDVS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-38 44
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-37 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
HTH_1434 YP_003433086.1 two-component transcriptional regulator NC_002952.2859905.p0 Protein 2e-37 45
HTH_1434 YP_003433086.1 two-component transcriptional regulator NC_002951.3237708.p0 Protein 3e-37 45
HTH_1434 YP_003433086.1 two-component transcriptional regulator NC_002758.1121668.p0 Protein 3e-37 45
HTH_1434 YP_003433086.1 two-component transcriptional regulator NC_009641.5332272.p0 Protein 3e-37 45
HTH_1434 YP_003433086.1 two-component transcriptional regulator NC_013450.8614421.p0 Protein 3e-37 45
HTH_1434 YP_003433086.1 two-component transcriptional regulator NC_007793.3914279.p0 Protein 3e-37 45
HTH_1434 YP_003433086.1 two-component transcriptional regulator NC_007622.3794472.p0 Protein 2e-37 45
HTH_1434 YP_003433086.1 two-component transcriptional regulator NC_002745.1124361.p0 Protein 3e-37 45
HTH_1434 YP_003433086.1 two-component transcriptional regulator NC_009782.5559369.p0 Protein 3e-37 45
HTH_1434 YP_003433086.1 two-component transcriptional regulator NC_007622.3794948.p0 Protein 1e-36 44
HTH_1434 YP_003433086.1 two-component transcriptional regulator NC_003923.1003417.p0 Protein 1e-36 44
HTH_1434 YP_003433086.1 two-component transcriptional regulator NC_013450.8614146.p0 Protein 1e-36 44
HTH_1434 YP_003433086.1 two-component transcriptional regulator NC_002951.3238224.p0 Protein 1e-36 44
HTH_1434 YP_003433086.1 two-component transcriptional regulator NC_007793.3914065.p0 Protein 1e-36 44
HTH_1434 YP_003433086.1 two-component transcriptional regulator NC_002758.1121390.p0 Protein 1e-36 44
HTH_1434 YP_003433086.1 two-component transcriptional regulator NC_010079.5776364.p0 Protein 1e-36 44
HTH_1434 YP_003433086.1 two-component transcriptional regulator NC_002952.2859858.p0 Protein 1e-36 44
HTH_1434 YP_003433086.1 two-component transcriptional regulator BAC0125 Protein 2e-39 44
HTH_1434 YP_003433086.1 two-component transcriptional regulator NC_003923.1003749.p0 Protein 4e-37 44
HTH_1434 YP_003433086.1 two-component transcriptional regulator NC_012469.1.7686381. Protein 2e-34 44
HTH_1434 YP_003433086.1 two-component transcriptional regulator AE015929.1.gene1106. Protein 6e-33 43
HTH_1434 YP_003433086.1 two-component transcriptional regulator BAC0111 Protein 3e-37 43
HTH_1434 YP_003433086.1 two-component transcriptional regulator NC_012469.1.7685629. Protein 9e-33 42
HTH_1434 YP_003433086.1 two-component transcriptional regulator BAC0347 Protein 4e-34 42
HTH_1434 YP_003433086.1 two-component transcriptional regulator AF155139.2.orf0.gene Protein 6e-35 42
HTH_1434 YP_003433086.1 two-component transcriptional regulator AF162694.1.orf4.gene Protein 2e-30 42
HTH_1434 YP_003433086.1 two-component transcriptional regulator BAC0197 Protein 5e-43 42
HTH_1434 YP_003433086.1 two-component transcriptional regulator HE999704.1.gene2815. Protein 1e-36 42
HTH_1434 YP_003433086.1 two-component transcriptional regulator HE999704.1.gene1528. Protein 3e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
HTH_1434 YP_003433086.1 two-component transcriptional regulator VFG0596 Protein 9e-39 44
HTH_1434 YP_003433086.1 two-component transcriptional regulator VFG1389 Protein 1e-36 44