Gene Information

Name : Kvar_3486 (Kvar_3486)
Accession : YP_003440398.1
Strain : Klebsiella variicola At-22
Genome accession: NC_013850
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3649911 - 3650627 bp
Length : 717 bp
Strand : -
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; transcriptional regulator domain protein; KEGG: kpe:KPK_3672 DNA-binding response regulator

DNA sequence :
ATGGCCAAAACCATTCTGCTGGTGGAAGATGACGAGGATATTGCCACGCTGCTGCGGCTCAATCTTCAGGATGAGGGCTA
TCAGATTGTGCATGAAGCCGACGGCGACCAGGCCCTTGTCCAGCTGGAAAAGCAGGTCTGGGATGCGGTGATCCTTGATT
TGATGCTGCCTGGCGTCGATGGCCTGGAGATCTGCCGGCGTATCCGTCAGATGACCCGTTACCTGCCAGTAATTATCATC
AGCGCTCGCACCAGCGAAATGCACCGCGTGCTGGGCCTGGAGATGGGCGCCGATGATTATCTGGCGAAGCCCTTTTCACT
GCTGGAGCTTATCGCCCGCGTCAAAGCGCTGTTTCGTCGCCAGGAGGCGATGGGGCAGAACCTGCTGATGGACGCCGGGC
GCCTGTCCTGCCATGGCCTGAGCATCGATCCGCTGTCGCGCGAAGTGAAGCTGCGCGGCGAGGTGGTGGACCTTACGCCG
CGCGAATTCGATCTGCTCTATTACTTCGCCCGCCATCCCGGTGAGGTGTTTTCGCGGCTGGCGCTGCTGGAGCAGGTCTG
GGGATATCAGCACGAGGGCTATGAGCACACGGTTAATACCCATATCAACCGCCTGCGCAGCAAAATCGAACGTGACCCGG
CGGAGCCGGACATCATTCTTACCGTCTGGGGTAAAGGCTATAAATTCGCCCCGATGTCGCAAGAGGTCGCCCCGTGA

Protein sequence :
MAKTILLVEDDEDIATLLRLNLQDEGYQIVHEADGDQALVQLEKQVWDAVILDLMLPGVDGLEICRRIRQMTRYLPVIII
SARTSEMHRVLGLEMGADDYLAKPFSLLELIARVKALFRRQEAMGQNLLMDAGRLSCHGLSIDPLSREVKLRGEVVDLTP
REFDLLYYFARHPGEVFSRLALLEQVWGYQHEGYEHTVNTHINRLRSKIERDPAEPDIILTVWGKGYKFAPMSQEVAP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 5e-86 79
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 6e-86 79

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Kvar_3486 YP_003440398.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 2e-43 47
Kvar_3486 YP_003440398.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 2e-39 45
Kvar_3486 YP_003440398.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 2e-41 42
Kvar_3486 YP_003440398.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 2e-38 42
Kvar_3486 YP_003440398.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 9e-34 42
Kvar_3486 YP_003440398.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 6e-43 42
Kvar_3486 YP_003440398.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 5e-35 41
Kvar_3486 YP_003440398.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 5e-35 41
Kvar_3486 YP_003440398.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 5e-35 41
Kvar_3486 YP_003440398.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 5e-35 41
Kvar_3486 YP_003440398.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 5e-35 41
Kvar_3486 YP_003440398.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 5e-35 41
Kvar_3486 YP_003440398.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 1e-29 41
Kvar_3486 YP_003440398.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 5e-35 41
Kvar_3486 YP_003440398.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 5e-35 41
Kvar_3486 YP_003440398.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 3e-42 41
Kvar_3486 YP_003440398.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 4e-43 41
Kvar_3486 YP_003440398.1 winged helix family two component transcriptional regulator CP001138.1.gene4273. Protein 2e-29 41
Kvar_3486 YP_003440398.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 8e-41 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Kvar_3486 YP_003440398.1 winged helix family two component transcriptional regulator VFG1563 Protein 3e-86 79
Kvar_3486 YP_003440398.1 winged helix family two component transcriptional regulator VFG1702 Protein 2e-86 79
Kvar_3486 YP_003440398.1 winged helix family two component transcriptional regulator VFG1389 Protein 1e-30 41