Gene Information

Name : merR (smi_0885)
Accession : YP_003446001.1
Strain : Streptococcus mitis B6
Genome accession: NC_013853
Putative virulence/resistance : Resistance
Product : mercuric resistance operon regulatory protein MerR
Function : -
COG functional category : K : Transcription
COG ID : COG0789
EC number : -
Position : 838692 - 839084 bp
Length : 393 bp
Strand : +
Note : -

DNA sequence :
ATGATTTATCGCATTAGTGAGTTTGCAGATAAATGTGGAGTTAATAAAGAAACGATCAGATATTACGAGCGAAAAAATTT
ATTACAAGAACCTCACCGAACGGAAGCTGGTTATCGGATATATTCATATGATGACGTTAAGCGTGTTGGGTTTATTAAAC
GAATACAGGAACTTGGTTTCTCTTTAAGCGAGATTTATAAATTACTTGGTGTTGTAGATAAAGATGAAGTTCGTTGTCAA
GATATGTTCGAATGTGTTTCTAAAAAACAAAAGGAAGTGCAAAAACAAATAGAGGATTTAAAACGAATTGAAACTATGTT
AGACGACTTAAAACAACGATGTCCAGATGAAAAGAAATTACATTCGTGTCCAATAATAGAAACATTAATATGA

Protein sequence :
MIYRISEFADKCGVNKETIRYYERKNLLQEPHRTEAGYRIYSYDDVKRVGFIKRIQELGFSLSEIYKLLGVVDKDEVRCQ
DMFECVSKKQKEVQKQIEDLKRIETMLDDLKQRCPDEKKLHSCPIIETLI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed BAB47646.1 orf2 Not tested Type-III SCCmec Protein 2e-33 56
SE0081 NP_763636.1 hypothetical protein Not tested SCCpbp4 Protein 3e-33 56
merR AET25401.1 MerR Not tested PAGI-2(C) Protein 1e-18 44
merR AFG30124.1 MerR Not tested PAGI-2 Protein 1e-18 44
merR AGK07025.1 MerR Not tested SGI1 Protein 4e-19 44
merR YP_006098391.1 mercuric resistance operon transcriptional regulator Not tested Tn2411 Protein 1e-18 44
merR AGK07083.1 MerR Not tested SGI1 Protein 4e-19 44
merR ACK44535.1 MerR Not tested SGI1 Protein 1e-18 44
merR CAJ77064.1 Mercury resistance operon regulatory protein Not tested AbaR1 Protein 7e-19 43
merR ACN81009.1 MerR activator/repressor of mer operon Not tested AbaR5 Protein 1e-18 43
unnamed ABR13397.1 mercuric resistance operon regulatory protein Not tested PAGI-5 Protein 3e-18 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
merR YP_003446001.1 mercuric resistance operon regulatory protein MerR BAC0682 Protein 9e-38 64
merR YP_003446001.1 mercuric resistance operon regulatory protein MerR BAC0680 Protein 1e-33 55
merR YP_003446001.1 mercuric resistance operon regulatory protein MerR BAC0688 Protein 2e-19 44
merR YP_003446001.1 mercuric resistance operon regulatory protein MerR BAC0684 Protein 1e-18 42
merR YP_003446001.1 mercuric resistance operon regulatory protein MerR BAC0686 Protein 1e-18 42
merR YP_003446001.1 mercuric resistance operon regulatory protein MerR BAC0687 Protein 1e-18 42
merR YP_003446001.1 mercuric resistance operon regulatory protein MerR BAC0683 Protein 3e-18 42
merR YP_003446001.1 mercuric resistance operon regulatory protein MerR BAC0232 Protein 1e-18 42