Gene Information

Name : AZL_a02800 (AZL_a02800)
Accession : YP_003450355.1
Strain :
Genome accession: NC_013855
Putative virulence/resistance : Virulence
Product : DNA-binding two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 357121 - 357780 bp
Length : 660 bp
Strand : -
Note : -

DNA sequence :
ATGCGCGTGCTGGTCGTCGAGGACACGCCGGAGCTGGCCCGGCAGCTGACACAGCGGCTGGCCCGCGAGGGCTACGCCGT
GGACGGCGCCGCCGACGGCGAGGAGGGACGCTTCCTCGGCGAGACCGAGCCCTATGACGCGGTGATTCTCGATCTCGGGC
TGCCGAAGATCGACGGGCTGACGGTCCTGCGCGGCTGGCGGCGGGCGGGCATCTCCGTTCCGGTGCTGATCCTGACCGCG
CGCGGCGCCTGGACCGAGAAGGTCCAGGGCATCGACGCCGGGGCCGACGACTATCTCGCCAAGCCCTTCAGCATGGAGGA
GCTGCTGGCCCGCGTGCGCGCCCTGATCCGCCGCGCCAAGGGCCATGCCAGCGCCGAGATCACCTGCGGCGGGGTGGTGC
TCGACACCAGGACCGGGCGGGTCACGGTGGATGGCGAGCCCATCGAACTGACCGCCTTCGAATACCGGGTCCTGTCCTAT
CTGATGCACCGCAAGGGGCAGGTGGTGTCGCGCACCGAGCTGACCGAGCATGTCTATGCCCAGGATTTCGACCGCGATTC
CAACACCATCGAGGTCTTCGTCGGTCGCCTGCGCCGCAAGCTGGGGGTGGACGTCATCAAGACGGTACGCGGGCTGGGCT
ACCGCGCCGACGAGCCGTAG

Protein sequence :
MRVLVVEDTPELARQLTQRLAREGYAVDGAADGEEGRFLGETEPYDAVILDLGLPKIDGLTVLRGWRRAGISVPVLILTA
RGAWTEKVQGIDAGADDYLAKPFSMEELLARVRALIRRAKGHASAEITCGGVVLDTRTGRVTVDGEPIELTAFEYRVLSY
LMHRKGQVVSRTELTEHVYAQDFDRDSNTIEVFVGRLRRKLGVDVIKTVRGLGYRADEP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-26 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
AZL_a02800 YP_003450355.1 DNA-binding two-component response regulator NC_002516.2.879194.p Protein 1e-41 49
AZL_a02800 YP_003450355.1 DNA-binding two-component response regulator CP000647.1.gene1136. Protein 2e-37 47
AZL_a02800 YP_003450355.1 DNA-binding two-component response regulator BAC0530 Protein 2e-37 47
AZL_a02800 YP_003450355.1 DNA-binding two-component response regulator CP001918.1.gene2526. Protein 6e-36 46
AZL_a02800 YP_003450355.1 DNA-binding two-component response regulator CP001138.1.gene1939. Protein 4e-37 46
AZL_a02800 YP_003450355.1 DNA-binding two-component response regulator BAC0487 Protein 1e-31 45
AZL_a02800 YP_003450355.1 DNA-binding two-component response regulator CP004022.1.gene1005. Protein 4e-38 45
AZL_a02800 YP_003450355.1 DNA-binding two-component response regulator CP000034.1.gene2022. Protein 2e-36 45
AZL_a02800 YP_003450355.1 DNA-binding two-component response regulator NC_002695.1.913289.p Protein 3e-35 44
AZL_a02800 YP_003450355.1 DNA-binding two-component response regulator BAC0083 Protein 1e-26 42
AZL_a02800 YP_003450355.1 DNA-binding two-component response regulator BAC0125 Protein 1e-27 42
AZL_a02800 YP_003450355.1 DNA-binding two-component response regulator BAC0308 Protein 2e-25 42
AZL_a02800 YP_003450355.1 DNA-binding two-component response regulator AE016830.1.gene1681. Protein 7e-31 41
AZL_a02800 YP_003450355.1 DNA-binding two-component response regulator BAC0197 Protein 1e-25 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
AZL_a02800 YP_003450355.1 DNA-binding two-component response regulator VFG0475 Protein 4e-37 46
AZL_a02800 YP_003450355.1 DNA-binding two-component response regulator VFG1390 Protein 6e-26 43
AZL_a02800 YP_003450355.1 DNA-binding two-component response regulator VFG0473 Protein 2e-28 43
AZL_a02800 YP_003450355.1 DNA-binding two-component response regulator VFG0596 Protein 1e-26 42
AZL_a02800 YP_003450355.1 DNA-binding two-component response regulator VFG1389 Protein 1e-23 41