Gene Information

Name : qseB (LLO_1159)
Accession : YP_003454638.1
Strain : Legionella longbeachae NSW150
Genome accession: NC_013861
Putative virulence/resistance : Virulence
Product : DNA-binding response regulator in two-component regulatory system with QseC
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1367661 - 1368338 bp
Length : 678 bp
Strand : -
Note : equals llo1159; similar to two component response regulator

DNA sequence :
ATGAGACTATTGCTGGTTGAAGATGATGAACTACTTGGTGATGCCGTAAAAACTGGATTAACACAGTTTGGCTATATTGT
TGATTGGCTTAAAGATGGTGAAGCTGCTCGTGCTGCTTTAAAATCTGAATCCTTCGAACTCATTATTCTTGATTTAGGAT
TGCCTAAACTCTCTGGACTTGCCTTACTGCAAAGTATTCGTAATGATGGAAATCCTACCCCTGTAATTATTTTAACAGCC
CGAGAGTCAGTAGAGGATCGTGTCAAAGGCTTAGATAGCGGGGCTGACGACTATCTAGTGAAACCTTTTGACCTAAATGA
ACTAAGCGCCAGAATTAGAGCACTGGTGAGGCGCTCACAAGGTCGTGCTGATGCTGTTTTGCAATATCGAAACATTACTC
TGGATCCAGCCGCACACTCTGTATTTGTTGATGATGTATTAGTCAATGTCCCGCGCAGAGAGTTCGCACTACTACAAAAA
CTTCTGGAAAACAGTGGCCAAGTTTTATCGCGCGAACAACTGATGCAAAGTATTTACGGCTGGGAAGAAGACGTAGACAG
TAATGCATTGGAAGTTCATATTCATAATTTACGTAAAAAACTTAATGCTAATTTTATTCGAACAATAAGAGGCGTTGGAT
ATATGGCAGAAAAAAATGATGGTATTATCGTATCGTGA

Protein sequence :
MRLLLVEDDELLGDAVKTGLTQFGYIVDWLKDGEAARAALKSESFELIILDLGLPKLSGLALLQSIRNDGNPTPVIILTA
RESVEDRVKGLDSGADDYLVKPFDLNELSARIRALVRRSQGRADAVLQYRNITLDPAAHSVFVDDVLVNVPRREFALLQK
LLENSGQVLSREQLMQSIYGWEEDVDSNALEVHIHNLRKKLNANFIRTIRGVGYMAEKNDGIIVS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-23 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
qseB YP_003454638.1 DNA-binding response regulator in two-component regulatory system with QseC NC_007793.3914065.p0 Protein 3e-24 41
qseB YP_003454638.1 DNA-binding response regulator in two-component regulatory system with QseC NC_002758.1121390.p0 Protein 3e-24 41
qseB YP_003454638.1 DNA-binding response regulator in two-component regulatory system with QseC NC_010079.5776364.p0 Protein 3e-24 41
qseB YP_003454638.1 DNA-binding response regulator in two-component regulatory system with QseC NC_002952.2859858.p0 Protein 3e-24 41
qseB YP_003454638.1 DNA-binding response regulator in two-component regulatory system with QseC NC_007622.3794948.p0 Protein 3e-24 41
qseB YP_003454638.1 DNA-binding response regulator in two-component regulatory system with QseC NC_003923.1003417.p0 Protein 3e-24 41
qseB YP_003454638.1 DNA-binding response regulator in two-component regulatory system with QseC NC_013450.8614146.p0 Protein 3e-24 41
qseB YP_003454638.1 DNA-binding response regulator in two-component regulatory system with QseC NC_002951.3238224.p0 Protein 3e-24 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
qseB YP_003454638.1 DNA-binding response regulator in two-component regulatory system with QseC VFG0473 Protein 3e-33 47
qseB YP_003454638.1 DNA-binding response regulator in two-component regulatory system with QseC VFG0596 Protein 1e-23 42