Gene Information

Name : lse_1422 (lse_1422)
Accession : YP_003464659.1
Strain : Listeria seeligeri SLCC3954
Genome accession: NC_013891
Putative virulence/resistance : Virulence
Product : DNA-binding response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1450406 - 1451092 bp
Length : 687 bp
Strand : +
Note : -

DNA sequence :
ATGAAACTACTTATGATTGAAGATAATGTGAGTGTATGTGAAATGATTGAAATGTTTTTCATGAAAGAAGAAATTGATGC
GACGTTTGTACACGATGGCAAAAAGGGTTATGAAACTTTTTTAAAAGAAGATTTTGATATTGCAATTATTGATTTAATGC
TTCCTAATATGGACGGAATGACTATCTGCCGAAAAATTCGCGAAGTCAGTGATATGCCGATTATTATTTTAACGGCGAAA
GAATCAGAGTCCGATCAAGTGCTAGGTCTTGAAATGGGTGCAGACGATTATGTTACTAAACCATTCAGCCCGCTTACGTT
GATGGCGCGAATTAAGGCTGTTACTCGCCGGAAAAATAGCGCAACACCTGCTGAAGCCGATGAAGATATTCTAGAAACAA
CTTATTTCAAAATAAGCAAACGTACTCGTGAAATTTTTTATCAAGGAGAACTACTGGACGCTTTAACACCAAAAGAATTT
GATCTGCTTTATTTCTTAATGAAGCACCCACGGCAAGTATTTTCAAGAGAACAATTACTCGAACAAGTCTGGGGTTATCA
ATTTTACGGGGATGAGCGGACAGTTGATGTGCATATTAAACGTCTGCGTCAAAAAATTGCCACTGATACTAAGCCGTTTT
TACACACAATATGGGGTGTCGGCTATAAATTTGATGAAACGGAATGA

Protein sequence :
MKLLMIEDNVSVCEMIEMFFMKEEIDATFVHDGKKGYETFLKEDFDIAIIDLMLPNMDGMTICRKIREVSDMPIIILTAK
ESESDQVLGLEMGADDYVTKPFSPLTLMARIKAVTRRKNSATPAEADEDILETTYFKISKRTREIFYQGELLDALTPKEF
DLLYFLMKHPRQVFSREQLLEQVWGYQFYGDERTVDVHIKRLRQKIATDTKPFLHTIWGVGYKFDETE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-35 45
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-35 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
lse_1422 YP_003464659.1 DNA-binding response regulator NC_012469.1.7686381. Protein 8e-42 45
lse_1422 YP_003464659.1 DNA-binding response regulator FJ349556.1.orf0.gene Protein 2e-38 44
lse_1422 YP_003464659.1 DNA-binding response regulator NC_012469.1.7685629. Protein 2e-38 43
lse_1422 YP_003464659.1 DNA-binding response regulator AE016830.1.gene1681. Protein 2e-40 43
lse_1422 YP_003464659.1 DNA-binding response regulator HE999704.1.gene2815. Protein 6e-44 43
lse_1422 YP_003464659.1 DNA-binding response regulator DQ212986.1.gene4.p01 Protein 7e-31 43
lse_1422 YP_003464659.1 DNA-binding response regulator CP000034.1.gene3671. Protein 8e-38 43
lse_1422 YP_003464659.1 DNA-binding response regulator CP001918.1.gene3444. Protein 2e-28 43
lse_1422 YP_003464659.1 DNA-binding response regulator AE015929.1.gene1106. Protein 6e-29 42
lse_1422 YP_003464659.1 DNA-binding response regulator AM180355.1.gene1830. Protein 4e-31 42
lse_1422 YP_003464659.1 DNA-binding response regulator NC_002695.1.916589.p Protein 3e-28 42
lse_1422 YP_003464659.1 DNA-binding response regulator BAC0039 Protein 3e-28 42
lse_1422 YP_003464659.1 DNA-binding response regulator CP000034.1.gene2186. Protein 3e-28 42
lse_1422 YP_003464659.1 DNA-binding response regulator NC_011595.7057856.p0 Protein 4e-38 41
lse_1422 YP_003464659.1 DNA-binding response regulator NC_010410.6002989.p0 Protein 4e-38 41
lse_1422 YP_003464659.1 DNA-binding response regulator NC_010400.5986590.p0 Protein 6e-38 41
lse_1422 YP_003464659.1 DNA-binding response regulator NC_002951.3238224.p0 Protein 2e-32 41
lse_1422 YP_003464659.1 DNA-binding response regulator NC_007793.3914065.p0 Protein 2e-32 41
lse_1422 YP_003464659.1 DNA-binding response regulator NC_002758.1121390.p0 Protein 2e-32 41
lse_1422 YP_003464659.1 DNA-binding response regulator NC_010079.5776364.p0 Protein 2e-32 41
lse_1422 YP_003464659.1 DNA-binding response regulator NC_002952.2859858.p0 Protein 2e-32 41
lse_1422 YP_003464659.1 DNA-binding response regulator NC_007622.3794948.p0 Protein 2e-32 41
lse_1422 YP_003464659.1 DNA-binding response regulator NC_003923.1003417.p0 Protein 2e-32 41
lse_1422 YP_003464659.1 DNA-binding response regulator NC_013450.8614146.p0 Protein 2e-32 41
lse_1422 YP_003464659.1 DNA-binding response regulator AF155139.2.orf0.gene Protein 1e-35 41
lse_1422 YP_003464659.1 DNA-binding response regulator NC_014475.1.orf0.gen Protein 3e-34 41
lse_1422 YP_003464659.1 DNA-binding response regulator NC_005054.2598277.p0 Protein 3e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
lse_1422 YP_003464659.1 DNA-binding response regulator VFG1563 Protein 8e-36 45
lse_1422 YP_003464659.1 DNA-binding response regulator VFG1702 Protein 1e-35 45