Gene Information

Name : covR (SmuNN2025_0587)
Accession : YP_003484505.1
Strain : Streptococcus mutans NN2025
Genome accession: NC_013928
Putative virulence/resistance : Virulence
Product : response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 615761 - 616468 bp
Length : 708 bp
Strand : +
Note : CovR; VicR homolog, similar to (nr):(gi|24379907|ref|NP_721862.1|), BLASTP E():2.45e-130, 100.0% identity in 235 aa overlap.

DNA sequence :
ATGAAGAAAATTCTAATCGTTGACGATGAAAAACCAATTTCTGATATCATCAAGTTTAACTTGGCTAAGGAAGGTTATGA
CACGATTACAGCCTTTGATGGGCGTGAAGCATTAAGTAAATATGAAGAAGAAAATCCTGACTTGATTATATTGGACTTAA
TGTTACCAGAACTAGACGGTCTTGAAGTGGCTAAGGAAGTTAGAAAAAACAGCCATGTTCCAATTATTATGTTATCAGCT
AAAGACAGTGAGTTTGATAAGGTTATTGGTCTTGAAATTGGTGCTGATGATTATGTGACTAAACCTTTTTCTAATCGTGA
ATTACTGGCGCGTGTAAAAGCGCATCTTCGCCGTACTGAAAATATTGAATCCGCAGTGGCTGAGGAAAATGCTTCAGGTA
TACCTGAAATTATTATTGGGGACTTGCAAATCTTACCAGATGCTTTTGTTGCTAAAAAACGTGGAACAGAGGTAGAGTTA
ACTCACCGTGAGTTTGAGCTGTTGCATCACTTAGCGACACACACAGGTCAGGTGATGACGCGTGAACATTTACTTGAAAC
GGTTTGGGGCTATGATTATTTTGGAGATGTCCGTACTGTTGATGTTACTGTTCGTCGTCTGCGTGAAAAAATTGAAGATA
CACCTAGTCGTCCAGAGTACATTTTGACGCGACGCGGTGTTGGTTATTACATGAAATCATATGACTAA

Protein sequence :
MKKILIVDDEKPISDIIKFNLAKEGYDTITAFDGREALSKYEEENPDLIILDLMLPELDGLEVAKEVRKNSHVPIIMLSA
KDSEFDKVIGLEIGADDYVTKPFSNRELLARVKAHLRRTENIESAVAEENASGIPEIIIGDLQILPDAFVAKKRGTEVEL
THREFELLHHLATHTGQVMTREHLLETVWGYDYFGDVRTVDVTVRRLREKIEDTPSRPEYILTRRGVGYYMKSYD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 6e-32 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 5e-32 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
covR YP_003484505.1 response regulator NC_012469.1.7685629. Protein 3e-80 79
covR YP_003484505.1 response regulator NC_002952.2859905.p0 Protein 6e-50 53
covR YP_003484505.1 response regulator NC_007793.3914279.p0 Protein 7e-50 53
covR YP_003484505.1 response regulator NC_002745.1124361.p0 Protein 7e-50 53
covR YP_003484505.1 response regulator NC_009782.5559369.p0 Protein 7e-50 53
covR YP_003484505.1 response regulator NC_002951.3237708.p0 Protein 7e-50 53
covR YP_003484505.1 response regulator NC_003923.1003749.p0 Protein 6e-50 53
covR YP_003484505.1 response regulator NC_002758.1121668.p0 Protein 7e-50 53
covR YP_003484505.1 response regulator NC_007622.3794472.p0 Protein 5e-50 53
covR YP_003484505.1 response regulator NC_009641.5332272.p0 Protein 7e-50 53
covR YP_003484505.1 response regulator NC_013450.8614421.p0 Protein 7e-50 53
covR YP_003484505.1 response regulator HE999704.1.gene2815. Protein 4e-50 53
covR YP_003484505.1 response regulator NC_012469.1.7686381. Protein 5e-42 49
covR YP_003484505.1 response regulator AE016830.1.gene1681. Protein 1e-43 47
covR YP_003484505.1 response regulator FJ349556.1.orf0.gene Protein 7e-38 45
covR YP_003484505.1 response regulator CP004022.1.gene3215. Protein 1e-31 45
covR YP_003484505.1 response regulator CP001918.1.gene5135. Protein 4e-23 45
covR YP_003484505.1 response regulator HE999704.1.gene1528. Protein 8e-31 44
covR YP_003484505.1 response regulator AM180355.1.gene1830. Protein 1e-36 44
covR YP_003484505.1 response regulator AF155139.2.orf0.gene Protein 2e-36 43
covR YP_003484505.1 response regulator DQ212986.1.gene4.p01 Protein 5e-35 43
covR YP_003484505.1 response regulator CP000034.1.gene3834. Protein 6e-28 43
covR YP_003484505.1 response regulator NC_002695.1.915041.p Protein 6e-28 43
covR YP_003484505.1 response regulator AE000516.2.gene3505. Protein 7e-33 42
covR YP_003484505.1 response regulator NC_013450.8614146.p0 Protein 1e-35 42
covR YP_003484505.1 response regulator NC_002951.3238224.p0 Protein 1e-35 42
covR YP_003484505.1 response regulator NC_007793.3914065.p0 Protein 1e-35 42
covR YP_003484505.1 response regulator NC_002758.1121390.p0 Protein 1e-35 42
covR YP_003484505.1 response regulator NC_010079.5776364.p0 Protein 1e-35 42
covR YP_003484505.1 response regulator AE015929.1.gene1106. Protein 7e-31 42
covR YP_003484505.1 response regulator NC_002952.2859858.p0 Protein 1e-35 42
covR YP_003484505.1 response regulator NC_007622.3794948.p0 Protein 1e-35 42
covR YP_003484505.1 response regulator NC_003923.1003417.p0 Protein 1e-35 42
covR YP_003484505.1 response regulator CP000647.1.gene4257. Protein 5e-28 42
covR YP_003484505.1 response regulator CP001138.1.gene4273. Protein 9e-28 42
covR YP_003484505.1 response regulator BAC0533 Protein 5e-28 42
covR YP_003484505.1 response regulator CP001485.1.gene721.p Protein 2e-26 41
covR YP_003484505.1 response regulator AF162694.1.orf4.gene Protein 2e-32 41
covR YP_003484505.1 response regulator CP000034.1.gene2186. Protein 1e-28 41
covR YP_003484505.1 response regulator NC_002695.1.916589.p Protein 1e-28 41
covR YP_003484505.1 response regulator BAC0039 Protein 1e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
covR YP_003484505.1 response regulator VFG1389 Protein 6e-31 43
covR YP_003484505.1 response regulator VFG1563 Protein 3e-32 42
covR YP_003484505.1 response regulator VFG1702 Protein 2e-32 42