Gene Information

Name : afsQ1 (SCAB_34801)
Accession : YP_003489123.1
Strain : Streptomyces scabiei 87.22
Genome accession: NC_013929
Putative virulence/resistance : Virulence
Product : two component system response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3925472 - 3926149 bp
Length : 678 bp
Strand : +
Note : -

DNA sequence :
GTGCCTTCCCTGTTGCTGATCGAGGACGACGACGCCATCCGCACGGCCCTGGAGCTCTCACTGACGCGCCAGGGGCACCG
TGTCGCCACCGCCGCCACCGGCGAGGATGGCCTCAAGCTGCTGCGCGAACAGCGGCCTGATCTGATCGTTTTGGACGTGA
TGCTGCCTGGGATCGACGGCTTCGAGGTGTGCCGGCGCATCCGGCGCACCGACCAGCTGCCGATCATCCTGCTCACGGCG
CGCAGCGACGACATCGACGTCGTGGTGGGCCTGGAGTCGGGCGCGGACGACTACGTGGTCAAGCCCGTGCAGGGGCGGGT
GCTGGACGCCCGTATCCGCGCGGTGCTGCGGCGCGGCGAGCGCGAGGCCAACGACGCGGCGACCTTCGGCTCCCTCGTGA
TCGACCGCGCGGCGATGACCGTGACGAAGAACGGCGAGGACCTCCAGCTGACACCCACCGAGCTGCGGCTGCTGTTGGAG
CTGAGCCGCCGCCCCGGACAGGCGCTGTCCCGGCAGCAGTTGCTGCGTCTGGTGTGGGAGCACGACTACCTGGGCGACTC
GCGCCTGGTGGACGCGTGTGTGCAGCGGCTGCGCGCCAAGGTCGAGGACGTGCCGTCCTCGCCGACGCTGATCCGTACCG
TGCGCGGCGTGGGCTACCGGTTGGACACTCCTCAGTGA

Protein sequence :
MPSLLLIEDDDAIRTALELSLTRQGHRVATAATGEDGLKLLREQRPDLIVLDVMLPGIDGFEVCRRIRRTDQLPIILLTA
RSDDIDVVVGLESGADDYVVKPVQGRVLDARIRAVLRRGEREANDAATFGSLVIDRAAMTVTKNGEDLQLTPTELRLLLE
LSRRPGQALSRQQLLRLVWEHDYLGDSRLVDACVQRLRAKVEDVPSSPTLIRTVRGVGYRLDTPQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-23 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
afsQ1 YP_003489123.1 two component system response regulator AE000516.2.gene3505. Protein 1e-34 47
afsQ1 YP_003489123.1 two component system response regulator NC_002952.2859905.p0 Protein 6e-38 44
afsQ1 YP_003489123.1 two component system response regulator NC_009782.5559369.p0 Protein 8e-38 44
afsQ1 YP_003489123.1 two component system response regulator NC_002951.3237708.p0 Protein 8e-38 44
afsQ1 YP_003489123.1 two component system response regulator NC_003923.1003749.p0 Protein 7e-38 44
afsQ1 YP_003489123.1 two component system response regulator NC_002758.1121668.p0 Protein 8e-38 44
afsQ1 YP_003489123.1 two component system response regulator NC_007622.3794472.p0 Protein 5e-38 44
afsQ1 YP_003489123.1 two component system response regulator NC_009641.5332272.p0 Protein 8e-38 44
afsQ1 YP_003489123.1 two component system response regulator NC_013450.8614421.p0 Protein 8e-38 44
afsQ1 YP_003489123.1 two component system response regulator NC_007793.3914279.p0 Protein 8e-38 44
afsQ1 YP_003489123.1 two component system response regulator NC_002745.1124361.p0 Protein 8e-38 44
afsQ1 YP_003489123.1 two component system response regulator NC_012469.1.7685629. Protein 1e-39 43
afsQ1 YP_003489123.1 two component system response regulator NC_002952.2859858.p0 Protein 2e-32 42
afsQ1 YP_003489123.1 two component system response regulator NC_007622.3794948.p0 Protein 2e-32 42
afsQ1 YP_003489123.1 two component system response regulator NC_003923.1003417.p0 Protein 2e-32 42
afsQ1 YP_003489123.1 two component system response regulator NC_013450.8614146.p0 Protein 2e-32 42
afsQ1 YP_003489123.1 two component system response regulator NC_002951.3238224.p0 Protein 2e-32 42
afsQ1 YP_003489123.1 two component system response regulator NC_007793.3914065.p0 Protein 2e-32 42
afsQ1 YP_003489123.1 two component system response regulator NC_002758.1121390.p0 Protein 2e-32 42
afsQ1 YP_003489123.1 two component system response regulator NC_010079.5776364.p0 Protein 2e-32 42
afsQ1 YP_003489123.1 two component system response regulator BAC0197 Protein 5e-26 42
afsQ1 YP_003489123.1 two component system response regulator AE015929.1.gene1106. Protein 5e-27 41
afsQ1 YP_003489123.1 two component system response regulator BAC0125 Protein 6e-24 41
afsQ1 YP_003489123.1 two component system response regulator NC_012469.1.7686381. Protein 3e-33 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
afsQ1 YP_003489123.1 two component system response regulator VFG1389 Protein 6e-23 42
afsQ1 YP_003489123.1 two component system response regulator VFG0596 Protein 5e-24 41
afsQ1 YP_003489123.1 two component system response regulator VFG1390 Protein 1e-27 41