Gene Information

Name : SCAB_4041 (SCAB_4041)
Accession : YP_003486180.1
Strain : Streptomyces scabiei 87.22
Genome accession: NC_013929
Putative virulence/resistance : Virulence
Product : response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 463202 - 463921 bp
Length : 720 bp
Strand : -
Note : -

DNA sequence :
GTGCTGGTGGTGGACGACGACCCCACGGTCGCGGAGGTCGTCACCGGCTACCTCGACCGGGCCGGATACACGGTGGACCG
CGCGGGCGACGGGCCGGCCGCGCTGGCCCGCGCCGCCGCGCACCGGCCCGACCTGGTCGTGCTGGACCTGATGCTGCCCG
GCATGGACGGCCTGGAGGTCTGCCGCCGGCTGAGGGCGCGCGGCCCGGTCCCGGTCATCATGCTCACCGCCCGAGGCGAC
GAGGACGACCGCATCCTGGGGCTGGAGGTCGGCGCCGACGACTACGTCACCAAGCCGTTCAGCCCGCGCGAACTGGTCCT
GCGCGTCGAGTCCGTGCTGCGCCGCGCACGGCCCGCGTCCGACGCCCGCCAGTTGACGGCGGCCGGTCTCCGTCTCGACC
CGGCCGCCCGGCACGCCACCCGCGATGGCGCCGAACTCGCGCTGACCCTGCGGGAGTTCGACCTCCTCGCCTTCTTCCTC
CGCAACCCGGGCCGTGCCCACAGCCGCGAGGACCTGATGCGCGAGGTCTGGGGCTGGGACTTCGGGGACCTGTCCACGGT
CACCGTCCATGTCCGCCGTCTGCGCGGCAAGATCGAGCACGACCCGGCGCAGCCCCGGCTGATCCGGACCGTGTGGGGCG
TCGGGTACCGCTTCGAGTCCGCAGACACCACGGCCGACGACGACGCGGAGCACGCCCCGGCCGAAGACAGGAAGGACTGA

Protein sequence :
MLVVDDDPTVAEVVTGYLDRAGYTVDRAGDGPAALARAAAHRPDLVVLDLMLPGMDGLEVCRRLRARGPVPVIMLTARGD
EDDRILGLEVGADDYVTKPFSPRELVLRVESVLRRARPASDARQLTAAGLRLDPAARHATRDGAELALTLREFDLLAFFL
RNPGRAHSREDLMREVWGWDFGDLSTVTVHVRRLRGKIEHDPAQPRLIRTVWGVGYRFESADTTADDDAEHAPAEDRKD

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 7e-28 43
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 5e-37 42
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-26 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 4e-36 41
CDB402_0209 YP_005126722.1 two-component system response regulator Not tested Not named Protein 2e-23 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SCAB_4041 YP_003486180.1 response regulator AE000516.2.gene3505. Protein 2e-35 46
SCAB_4041 YP_003486180.1 response regulator NC_012469.1.7685629. Protein 9e-39 45
SCAB_4041 YP_003486180.1 response regulator BAC0197 Protein 9e-30 45
SCAB_4041 YP_003486180.1 response regulator NC_002952.2859905.p0 Protein 2e-40 44
SCAB_4041 YP_003486180.1 response regulator NC_003923.1003749.p0 Protein 2e-40 44
SCAB_4041 YP_003486180.1 response regulator NC_002758.1121668.p0 Protein 2e-40 44
SCAB_4041 YP_003486180.1 response regulator NC_009641.5332272.p0 Protein 2e-40 44
SCAB_4041 YP_003486180.1 response regulator NC_013450.8614421.p0 Protein 2e-40 44
SCAB_4041 YP_003486180.1 response regulator NC_007793.3914279.p0 Protein 2e-40 44
SCAB_4041 YP_003486180.1 response regulator NC_007622.3794472.p0 Protein 2e-40 44
SCAB_4041 YP_003486180.1 response regulator NC_002745.1124361.p0 Protein 2e-40 44
SCAB_4041 YP_003486180.1 response regulator NC_009782.5559369.p0 Protein 2e-40 44
SCAB_4041 YP_003486180.1 response regulator NC_002951.3237708.p0 Protein 2e-40 44
SCAB_4041 YP_003486180.1 response regulator NC_008702.1.4607594. Protein 5e-33 43
SCAB_4041 YP_003486180.1 response regulator BAC0083 Protein 8e-33 42
SCAB_4041 YP_003486180.1 response regulator BAC0111 Protein 1e-34 42
SCAB_4041 YP_003486180.1 response regulator HE999704.1.gene2815. Protein 3e-38 42
SCAB_4041 YP_003486180.1 response regulator CP000647.1.gene2531. Protein 2e-34 42
SCAB_4041 YP_003486180.1 response regulator NC_010410.6002989.p0 Protein 1e-33 41
SCAB_4041 YP_003486180.1 response regulator BAC0347 Protein 1e-31 41
SCAB_4041 YP_003486180.1 response regulator NC_011595.7057856.p0 Protein 1e-33 41
SCAB_4041 YP_003486180.1 response regulator NC_010400.5986590.p0 Protein 7e-34 41
SCAB_4041 YP_003486180.1 response regulator BAC0638 Protein 3e-25 41
SCAB_4041 YP_003486180.1 response regulator CP000034.1.gene3671. Protein 1e-39 41
SCAB_4041 YP_003486180.1 response regulator BAC0039 Protein 4e-34 41
SCAB_4041 YP_003486180.1 response regulator CP001918.1.gene3444. Protein 1e-33 41
SCAB_4041 YP_003486180.1 response regulator CP001138.1.gene2239. Protein 5e-34 41
SCAB_4041 YP_003486180.1 response regulator CP000034.1.gene2186. Protein 4e-34 41
SCAB_4041 YP_003486180.1 response regulator NC_002695.1.916589.p Protein 3e-34 41
SCAB_4041 YP_003486180.1 response regulator BAC0596 Protein 5e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SCAB_4041 YP_003486180.1 response regulator VFG1390 Protein 5e-33 45
SCAB_4041 YP_003486180.1 response regulator VFG1386 Protein 1e-28 44
SCAB_4041 YP_003486180.1 response regulator VFG1389 Protein 7e-26 44
SCAB_4041 YP_003486180.1 response regulator VFG0596 Protein 3e-28 43
SCAB_4041 YP_003486180.1 response regulator VFG1563 Protein 3e-37 42
SCAB_4041 YP_003486180.1 response regulator VFG1702 Protein 2e-36 41