Gene Information

Name : SCAB_64341 (SCAB_64341)
Accession : YP_003491980.1
Strain : Streptomyces scabiei 87.22
Genome accession: NC_013929
Putative virulence/resistance : Resistance
Product : stress protein
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG2310
EC number : -
Position : 7128591 - 7129166 bp
Length : 576 bp
Strand : +
Note : -

DNA sequence :
ATGGGCGTCACACTCGCCAAGGGAGGCAATGTCTCCCTCTCCAAGGCCGCGCCGAACCTCACGCACGTGTTGGTCGGTCT
CGGCTGGGACGTCAGAACCACCACCGGAGCACCCTTCGACCTCGACGCCAGCGCTCTGCTGTGCCAGGGCGGCCGGGTGC
TGGGCGACGAGTGGTTCGTCTTCTACAACAACCTCAAGAGCCCCGACGGCTCGGTCGAGCACACCGGCGACAACCTCACC
GGTGAGGGCGACGGCGACGACGAGTCGCTGATCATCGACCTCTCCCGGGTGCCGGTCACCGTCGACAAGATCGTCTTTCC
GGTCTCCATCCATGACGCCGAGAACCGCGGCCAGGCGTTCGGCCAGGTCAGCAATGCGTTCATCCGCGTCGTCAACCAGG
CCGACGGTCAGGAACTCGCTCGTTACGACCTTTCCGAGGATGCCTCCACCGAGACCGCGATGATCTTCGGTGAGGTCTAC
CGCTATGGCGGGGAATGGAAGTTCCGGGCGGTGGGGCAGGGGTACGCGTCCGGTCTTCGGGGCATCGCACTCGACTTCGG
TGTGAACGTGTCGTAG

Protein sequence :
MGVTLAKGGNVSLSKAAPNLTHVLVGLGWDVRTTTGAPFDLDASALLCQGGRVLGDEWFVFYNNLKSPDGSVEHTGDNLT
GEGDGDDESLIIDLSRVPVTVDKIVFPVSIHDAENRGQAFGQVSNAFIRVVNQADGQELARYDLSEDASTETAMIFGEVY
RYGGEWKFRAVGQGYASGLRGIALDFGVNVS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
terD_2 NP_287118.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-58 69
terD NP_286710.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 8e-58 69
tlrC AAF36435.1 putative tellurium resistance protein C Not tested TAI Protein 2e-57 68
unnamed ACY75542.1 tellurium-resistance protein Not tested Tn6060 Protein 1e-60 68
tlrB AAF36434.1 putative tellurium resistance protein B Not tested TAI Protein 3e-53 62
terE NP_286711.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-53 62
terE_2 NP_287119.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 5e-53 62
unnamed ACY75541.1 tellurium-resistance protein Not tested Tn6060 Protein 3e-53 61
terZ ACY75546.1 tellurite resistance protein TerZ Not tested Tn6060 Protein 5e-28 43
terZ NP_286706.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-26 42
terZ_2 NP_287114.1 phage inhibition, colicin resistance and tellurite resistance protein Not tested TAI Protein 6e-26 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
SCAB_64341 YP_003491980.1 stress protein BAC0389 Protein 2e-57 68
SCAB_64341 YP_003491980.1 stress protein BAC0390 Protein 2e-57 63
SCAB_64341 YP_003491980.1 stress protein BAC0392 Protein 9e-26 41