Gene Information

Name : Mrub_1539 (Mrub_1539)
Accession : YP_003507321.1
Strain : Meiothermus ruber DSM 1279
Genome accession: NC_013946
Putative virulence/resistance : Resistance
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1573593 - 1574261 bp
Length : 669 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; InterPro IPR001789:IPR001867; KEGG: ade:Adeh_0411 two component transcriptional regulator; COGs: COG0745 Response regulators consisting of a C

DNA sequence :
ATGTCGAAACTGCTGCTGGTCGAGGACGAACCCTCTGTGCGGCTGGGGCTCCGCCTTTCACTTTCGAAGGCCGGGCATCA
GGTGCTGGAAGCAGCCACGGCTGCGGAAGCCTGGGAGAAGATGCCAGCCGCCGATCTGGTCATACTGGACTGGATGCTGC
CGGACGAACCCGGTTTGCGCCTGCTGGAGCGCCTGCGTCGCGATGGGCGCTATGAGCAACTACCGGTGTTGATGCTTACC
GCCCGGGCCGGTGAGGAGGATCGCGTGGAGGGTCTGACCCGCGGAGCTGACGATTACCTGACAAAGCCCTTCTCCACCCC
TGAGCTTATCGCGCGGGTGCAGGCCCTGCTGCGCCGGGTAGGCAAGAGCGGTCGCCTCGAGCGCGGGGCCCTGAGCCTCG
ACCTGGAGCGGCACCAGGCGTTTTTGGATGGTCACAGCCTCGAGCTCACCCGGCGGGAGTTTGAACTGCTGGCCTTTTTG
GCGCGGCACCCAGGGCGGGTTTATACCCGCGAAGAGCTGCTCGAGCGGGTCTGGGGTCAGGAGTTTTTGGGTACGGCCCG
AACGGTGGATCAGCACATTGCCCAACTGCGCGATAAACTGAGTGAAGACCCCAAGGCCCCACGTTTCCTGGAGACCCTCC
GCGGGGTTGGTTACCGGTTTAGGGAGTAA

Protein sequence :
MSKLLLVEDEPSVRLGLRLSLSKAGHQVLEAATAAEAWEKMPAADLVILDWMLPDEPGLRLLERLRRDGRYEQLPVLMLT
ARAGEEDRVEGLTRGADDYLTKPFSTPELIARVQALLRRVGKSGRLERGALSLDLERHQAFLDGHSLELTRREFELLAFL
ARHPGRVYTREELLERVWGQEFLGTARTVDQHIAQLRDKLSEDPKAPRFLETLRGVGYRFRE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 2e-26 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 4e-31 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-30 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mrub_1539 YP_003507321.1 winged helix family two component transcriptional regulator CP001918.1.gene5135. Protein 1e-23 48
Mrub_1539 YP_003507321.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 6e-32 43
Mrub_1539 YP_003507321.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 1e-33 43
Mrub_1539 YP_003507321.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-33 43
Mrub_1539 YP_003507321.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-33 43
Mrub_1539 YP_003507321.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-33 43
Mrub_1539 YP_003507321.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-33 43
Mrub_1539 YP_003507321.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-33 43
Mrub_1539 YP_003507321.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-33 43
Mrub_1539 YP_003507321.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-33 43
Mrub_1539 YP_003507321.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-33 43
Mrub_1539 YP_003507321.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-33 43
Mrub_1539 YP_003507321.1 winged helix family two component transcriptional regulator AF310956.2.orf0.gene Protein 6e-27 42
Mrub_1539 YP_003507321.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 9e-35 42
Mrub_1539 YP_003507321.1 winged helix family two component transcriptional regulator BAC0083 Protein 4e-23 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mrub_1539 YP_003507321.1 winged helix family two component transcriptional regulator VFG1390 Protein 4e-25 41
Mrub_1539 YP_003507321.1 winged helix family two component transcriptional regulator VFG1563 Protein 2e-31 41
Mrub_1539 YP_003507321.1 winged helix family two component transcriptional regulator VFG1702 Protein 7e-31 41