Gene Information

Name : Snas_2104 (Snas_2104)
Accession : YP_003510891.1
Strain : Stackebrandtia nassauensis DSM 44728
Genome accession: NC_013947
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2229501 - 2230178 bp
Length : 678 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: pca:Pcar_3081 two component signal transduction response regulator

DNA sequence :
ATGCGACTTTTGATTGTTGAGGACGAGAAACGCCTGGCAGATGTGGTGGCCGCGGGGTTGACCGCTGAGGGGTATGGCGT
GGATGTGGCGAACGACGGGACCACGGGGTTCTCGATGGCTCGTCAGAATCCTTATGACGTCATCATTTTGGACATCATGT
TGCCGGGGATGAACGGGTATCAGGTTTGCCGGAAGTTGCGGGAGGCGGAGGTGCGCACTCCGATTCTGATGCTGACCGCC
AAGGACGGGGAGCATGATGAGGCGGACGGGTTGGATTTGGGAGCGGACGACTATCTGACGAAGCCGTTCTCGTTCGTGGT
GTTGCAGGCGCGGATTCGGGCTTTGTTGCGGCGGTCGGTGAGTACCGCTCCTACGGTGTGGGAGTTCGGGGATCTGGTGA
TCGATCCGGCGGCGAAGACGGTGCGGCGAGGGGAGGCGGACATCTCGTTGACCGCCAAGGAGTTCGCGGTGCTGGAGTAC
CTGGCCAGTCGGGCGGGGGAGGTGGTGTCCAAGACCGAGGTGCTGGAGCACGTGTGGGACTTCGCGTACGACGGGGATGT
GAACATCGTGGAGGTGTACATCTCGTACCTGCGGCGCAAGTTGGACGCGCCGTTCGGGCGGCAGGCGATCACGACGCTGC
GCGGGGCCGGGTATCGATTGGCGGCCGACGGTGGCTGA

Protein sequence :
MRLLIVEDEKRLADVVAAGLTAEGYGVDVANDGTTGFSMARQNPYDVIILDIMLPGMNGYQVCRKLREAEVRTPILMLTA
KDGEHDEADGLDLGADDYLTKPFSFVVLQARIRALLRRSVSTAPTVWEFGDLVIDPAAKTVRRGEADISLTAKEFAVLEY
LASRAGEVVSKTEVLEHVWDFAYDGDVNIVEVYISYLRRKLDAPFGRQAITTLRGAGYRLAADGG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-39 47
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 5e-39 46

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Snas_2104 YP_003510891.1 winged helix family two component transcriptional regulator BAC0125 Protein 2e-39 48
Snas_2104 YP_003510891.1 winged helix family two component transcriptional regulator BAC0083 Protein 6e-38 46
Snas_2104 YP_003510891.1 winged helix family two component transcriptional regulator BAC0308 Protein 5e-39 46
Snas_2104 YP_003510891.1 winged helix family two component transcriptional regulator U82965.2.orf14.gene. Protein 6e-30 45
Snas_2104 YP_003510891.1 winged helix family two component transcriptional regulator Y16952.3.orf35.gene. Protein 3e-24 44
Snas_2104 YP_003510891.1 winged helix family two component transcriptional regulator BAC0111 Protein 5e-42 44
Snas_2104 YP_003510891.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 4e-35 44
Snas_2104 YP_003510891.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 4e-35 44
Snas_2104 YP_003510891.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 4e-35 44
Snas_2104 YP_003510891.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 4e-35 44
Snas_2104 YP_003510891.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 4e-35 44
Snas_2104 YP_003510891.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 4e-35 44
Snas_2104 YP_003510891.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 4e-35 44
Snas_2104 YP_003510891.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 4e-35 44
Snas_2104 YP_003510891.1 winged helix family two component transcriptional regulator BAC0197 Protein 1e-34 44
Snas_2104 YP_003510891.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 4e-33 43
Snas_2104 YP_003510891.1 winged helix family two component transcriptional regulator BAC0638 Protein 1e-30 43
Snas_2104 YP_003510891.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 2e-31 42
Snas_2104 YP_003510891.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 7e-32 42
Snas_2104 YP_003510891.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 9e-32 42
Snas_2104 YP_003510891.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 6e-32 42
Snas_2104 YP_003510891.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 9e-32 42
Snas_2104 YP_003510891.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 9e-32 42
Snas_2104 YP_003510891.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 9e-32 42
Snas_2104 YP_003510891.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 9e-32 42
Snas_2104 YP_003510891.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 9e-32 42
Snas_2104 YP_003510891.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 9e-32 42
Snas_2104 YP_003510891.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 8e-32 42
Snas_2104 YP_003510891.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 4e-33 41
Snas_2104 YP_003510891.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 2e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Snas_2104 YP_003510891.1 winged helix family two component transcriptional regulator VFG0596 Protein 6e-40 47
Snas_2104 YP_003510891.1 winged helix family two component transcriptional regulator VFG1390 Protein 1e-40 42
Snas_2104 YP_003510891.1 winged helix family two component transcriptional regulator VFG1386 Protein 5e-40 41