Gene Information

Name : Snas_4900 (Snas_4900)
Accession : YP_003513634.1
Strain : Stackebrandtia nassauensis DSM 44728
Genome accession: NC_013947
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 5205355 - 5206020 bp
Length : 666 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: ajs:Ajs_1461 two component heavy metal response transcriptional regulator

DNA sequence :
ATGAGCCGCATTCTGATCATCGAGGACTCCGAGCGCATCACCGCGTTCCTGACCAAGGGGCTGGCGGCGGCGGGGTTCAC
GCCGAGCGTGGCCCACACCGGGGCCGAGGGGCTGGGGCGGGCGTTGACCGGCGAGGTGGACCTGATCGTCCTGGACATCG
GTCTGCCCGATATGGACGGTTTCGATCTGTTGCGAGCGTTGCGGGCCGCGGGCCGGGACACGCCGGTGATCATCCTGACG
GCGCGCGACAGCGCCACCGACCGGGTGACGGGCCTGTCGGACGGGGCCGACGACTACATGCCCAAACCGTTCTCGGTGGA
CGAACTGCTGGCCCGGATCCGGTTGCGGCTGCGTCCGGTCTCGGGCGGCGGCAGCGACCAGGCGGTGCTGCGGGTCGGGG
ACCTGGAGCTGGACCTGCGCACCCGGGCGGTGCGGGCCGGTGGCCGTCAGGTGGAGCTGACCGCCCGGGAGCTGTCGCTT
CTGGACACGTTGATGCGCAACGCCGGGCAGGTGCTGTCGCGCGAGCAGCTGCTGAGCCGGGTGTGGGGTTTCGACTTCGA
TCCCGGGTCCAATGTGGTGGACGTCTACGTGCGGTACCTGCGCCGCAAGATCGGCGCCGACCGTATCGAAACGGTGCGGG
GCCTGGGGTACCGGCTCACCCAATGA

Protein sequence :
MSRILIIEDSERITAFLTKGLAAAGFTPSVAHTGAEGLGRALTGEVDLIVLDIGLPDMDGFDLLRALRAAGRDTPVIILT
ARDSATDRVTGLSDGADDYMPKPFSVDELLARIRLRLRPVSGGGSDQAVLRVGDLELDLRTRAVRAGGRQVELTARELSL
LDTLMRNAGQVLSREQLLSRVWGFDFDPGSNVVDVYVRYLRRKIGADRIETVRGLGYRLTQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-37 44
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-36 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Snas_4900 YP_003513634.1 winged helix family two component transcriptional regulator BAC0197 Protein 5e-39 48
Snas_4900 YP_003513634.1 winged helix family two component transcriptional regulator BAC0125 Protein 1e-41 46
Snas_4900 YP_003513634.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 1e-37 45
Snas_4900 YP_003513634.1 winged helix family two component transcriptional regulator BAC0347 Protein 7e-38 44
Snas_4900 YP_003513634.1 winged helix family two component transcriptional regulator BAC0111 Protein 2e-41 44
Snas_4900 YP_003513634.1 winged helix family two component transcriptional regulator BAC0083 Protein 2e-42 44
Snas_4900 YP_003513634.1 winged helix family two component transcriptional regulator BAC0638 Protein 5e-37 44
Snas_4900 YP_003513634.1 winged helix family two component transcriptional regulator BAC0308 Protein 7e-40 43
Snas_4900 YP_003513634.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 2e-40 42
Snas_4900 YP_003513634.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 2e-40 42
Snas_4900 YP_003513634.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 2e-40 42
Snas_4900 YP_003513634.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 2e-40 42
Snas_4900 YP_003513634.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 2e-40 42
Snas_4900 YP_003513634.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 2e-40 42
Snas_4900 YP_003513634.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 2e-40 42
Snas_4900 YP_003513634.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 2e-40 42
Snas_4900 YP_003513634.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 2e-36 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Snas_4900 YP_003513634.1 winged helix family two component transcriptional regulator VFG1389 Protein 8e-39 47
Snas_4900 YP_003513634.1 winged helix family two component transcriptional regulator VFG1390 Protein 8e-44 44
Snas_4900 YP_003513634.1 winged helix family two component transcriptional regulator VFG0596 Protein 7e-38 44
Snas_4900 YP_003513634.1 winged helix family two component transcriptional regulator VFG1386 Protein 7e-42 43