Gene Information

Name : Snas_0721 (Snas_0721)
Accession : YP_003509526.1
Strain : Stackebrandtia nassauensis DSM 44728
Genome accession: NC_013947
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 760882 - 761583 bp
Length : 702 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: bpt:Bpet2466 two-component response regulator

DNA sequence :
ATGACGCAACAGATCGCTCACATCCTCGTCGTCGAGGACGACCCCAACGTGTCTGATGTGGTGCGTCGCTATCTGGAGCG
GGAGGGGTACCGGGTGACCCTCGCCGCCGACGGGCTGTCCGGGCTGGCCGAGTACCGGTCCGGGCGGCCCGATCTGGTCG
TGCTCGACCTGATGCTGCCCAAACTGCCGGGCATCGAGGTGTGCCGGGCACTGCGCATCGAGTCCGAGGTGCCGGTCATC
ATGCTGACCGCGCTGGGCGACGAGTCCGACCGCATCGCCGGACTGAGCGTCGGCGCCGACGACTACCTGTCCAAGCCGTT
CTCGCCGCGCGAACTGGTGCTGCGGGTGGCGGCGGTGCTGCGCCGCGCGGTCCGCACCGAGGCGGCGGAGCGGCCGGGGG
AGCAGCTGACCGACGGCGAACTGATCCTCGACCCCGGCTCCCGGGTCGCGACGCTGCGCGGCACGAAACTGAACCTCACC
GTGCGGGAGTTCGACCTGCTGGAGTTCCTGCTGCGGCACCCCGGTCAGGTGTTCTCGCGGGCAGAACTGCTGGAACGGGT
GTGGGACTGGACCTTCGGCGACCAGTCCACCGTCACCGTCCACGTCAGACGGCTGCGCGAGAAGATCGAGGACGCGCCCG
CGCAGCCCAAACGGCTCGTGACGGTGTGGGGCGTCGGCTACCGCTTCGAGGCCACGTCATGA

Protein sequence :
MTQQIAHILVVEDDPNVSDVVRRYLEREGYRVTLAADGLSGLAEYRSGRPDLVVLDLMLPKLPGIEVCRALRIESEVPVI
MLTALGDESDRIAGLSVGADDYLSKPFSPRELVLRVAAVLRRAVRTEAAERPGEQLTDGELILDPGSRVATLRGTKLNLT
VREFDLLEFLLRHPGQVFSRAELLERVWDWTFGDQSTVTVHVRRLREKIEDAPAQPKRLVTVWGVGYRFEATS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
CDB402_0209 YP_005126722.1 two-component system response regulator Not tested Not named Protein 1e-25 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-34 41
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-33 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Snas_0721 YP_003509526.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 2e-37 44
Snas_0721 YP_003509526.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 1e-37 44
Snas_0721 YP_003509526.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 2e-36 43
Snas_0721 YP_003509526.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-36 43
Snas_0721 YP_003509526.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-36 43
Snas_0721 YP_003509526.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 2e-36 43
Snas_0721 YP_003509526.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-36 43
Snas_0721 YP_003509526.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-36 43
Snas_0721 YP_003509526.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-36 43
Snas_0721 YP_003509526.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-36 43
Snas_0721 YP_003509526.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-36 43
Snas_0721 YP_003509526.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-36 43
Snas_0721 YP_003509526.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-36 43
Snas_0721 YP_003509526.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 3e-31 41
Snas_0721 YP_003509526.1 winged helix family two component transcriptional regulator BAC0039 Protein 3e-31 41
Snas_0721 YP_003509526.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 3e-31 41
Snas_0721 YP_003509526.1 winged helix family two component transcriptional regulator AF162694.1.orf4.gene Protein 2e-30 41
Snas_0721 YP_003509526.1 winged helix family two component transcriptional regulator NC_008702.1.4607594. Protein 4e-26 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Snas_0721 YP_003509526.1 winged helix family two component transcriptional regulator VFG1390 Protein 6e-31 45
Snas_0721 YP_003509526.1 winged helix family two component transcriptional regulator VFG1702 Protein 1e-34 41
Snas_0721 YP_003509526.1 winged helix family two component transcriptional regulator VFG1563 Protein 9e-34 41
Snas_0721 YP_003509526.1 winged helix family two component transcriptional regulator VFG1389 Protein 3e-24 41