Gene Information

Name : Slit_0587 (Slit_0587)
Accession : YP_003523214.1
Strain : Sideroxydans lithotrophicus ES-1
Genome accession: NC_013959
Putative virulence/resistance : Virulence
Product : flagellar biosynthetic protein FliQ
Function : -
COG functional category : N : Cell motility
COG ID : COG1987
EC number : -
Position : 599478 - 599747 bp
Length : 270 bp
Strand : -
Note : KEGG: mei:Msip34_0767 flagellar biosynthetic protein FliQ; TIGRFAM: flagellar biosynthetic protein FliQ; PFAM: export protein FliQ family 3

DNA sequence :
GTGACCCCCGAATCGGTAATGACCATAGGTCAGCAGGCACTTGAGTTGACGATCATGGTGTCTGCGCCCCCGCTGCTCAC
CGCGCTCATCATCGGCTTGCTCGTCAGCATCTTCCAGGCCGCGACACAGATCAACGAGCTCACGCTGTCGTTCATCCCCA
AGCTGCTCGGCGCGTTCGTCGTCCTCATCATCTCCGGCCCGTGGATGATCGGCATACTCCTGGATTACATAACGCGTCTG
TTCAGCAGCATCCCCTACCTGGTCGGGTGA

Protein sequence :
MTPESVMTIGQQALELTIMVSAPPLLTALIIGLLVSIFQAATQINELTLSFIPKLLGAFVVLIISGPWMIGILLDYITRL
FSSIPYLVG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
hrcS AAB06006.1 HrcS Virulence Hrp PAI Protein 1e-08 43
spaQ NP_457283.1 secretory protein (associated with virulence) Virulence SPI-1 Protein 7e-07 42
spaQ NP_806492.1 virulence-associated secretory protein Virulence SPI-1 Protein 7e-07 42
spaQ NP_461810.1 needle complex export protein Virulence SPI-1 Protein 7e-07 42
spaQ YP_217808.1 surface presentation of antigens; secretory proteins Virulence SPI-1 Protein 7e-07 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Slit_0587 YP_003523214.1 flagellar biosynthetic protein FliQ VFG2339 Protein 4e-18 58
Slit_0587 YP_003523214.1 flagellar biosynthetic protein FliQ VFG2495 Protein 2e-11 58
Slit_0587 YP_003523214.1 flagellar biosynthetic protein FliQ VFG2015 Protein 3e-16 51
Slit_0587 YP_003523214.1 flagellar biosynthetic protein FliQ VFG1260 Protein 3e-14 45
Slit_0587 YP_003523214.1 flagellar biosynthetic protein FliQ VFG0550 Protein 2e-07 42
Slit_0587 YP_003523214.1 flagellar biosynthetic protein FliQ VFG2132 Protein 2e-10 42
Slit_0587 YP_003523214.1 flagellar biosynthetic protein FliQ VFG0187 Protein 0.003 41