
|
Name : Nhal_1678 (Nhal_1678) Accession : YP_003527193.1 Strain : Nitrosococcus halophilus Nc 4 Genome accession: NC_013960 Putative virulence/resistance : Resistance Product : mercuric transporter periplasmic component Function : - COG functional category : P : Inorganic ion transport and metabolism COG ID : COG2608 EC number : - Position : 1708341 - 1708640 bp Length : 300 bp Strand : - Note : TIGRFAM: mercuric transporter periplasmic component; PFAM: Heavy metal transport/detoxification protein; KEGG: amc:MADE_01410 periplasmic mercuric ion binding protein MerP DNA sequence : ATGAAACACGGGGTTATTGTGCTGGTTTTTATGGTCGGTTTGCTGAGTACTGCCGGGGCCTGGGCGGGTGAAAAGACCGT CACCCTTGAGGTAGAGAACATGACCTGCGCCCTCTGCCCGGTCACGGTTCGCAAGGCCCTAGAAGCCCTAGACGGGGTGC AGAAGGTGGAAATCTCCCTTGCTAATAAAACCGCGAGGGTGACATTCGAGGACGAAAAGACGACTCTTTCCGCCCTGACG GCGGCAACCACCCATGCAGGCTATCCGTCTCGTCTTTCCCGGGAGAAAGCCCATGAATAA Protein sequence : MKHGVIVLVFMVGLLSTAGAWAGEKTVTLEVENMTCALCPVTVRKALEALDGVQKVEISLANKTARVTFEDEKTTLSALT AATTHAGYPSRLSREKAHE |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| merP | ACN81007.1 | MerP periplasmic mercuric ion binding protein | Not tested | AbaR5 | Protein | 1e-10 | 53 |
| merP | CAJ77062.1 | Periplasmic mercuric ion binding protein | Not tested | AbaR1 | Protein | 8e-11 | 53 |
| merP | AAN62179.1 | periplasmic mercuric ion binding protein MerP | Not tested | PAGI-2(C) | Protein | 8e-11 | 53 |
| unnamed | ABR13399.1 | copper-transporting ATPase 2 | Not tested | PAGI-5 | Protein | 9e-12 | 50 |
| merP | AGK07023.1 | MerP | Not tested | SGI1 | Protein | 7e-11 | 50 |
| merP | AGK07081.1 | MerP | Not tested | SGI1 | Protein | 7e-11 | 50 |
| merP | YP_006098389.1 | mercuric ion transport protein | Not tested | Tn2411 | Protein | 1e-10 | 50 |
| merP | ABQ57373.1 | MerP | Not tested | SGI1 | Protein | 7e-11 | 50 |
| merP | AET25399.1 | MerP | Not tested | PAGI-2(C) | Protein | 7e-11 | 50 |
| merP | AFG30122.1 | MerP | Not tested | PAGI-2 | Protein | 7e-11 | 50 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| Nhal_1678 | YP_003527193.1 | mercuric transporter periplasmic component | BAC0675 | Protein | 2e-11 | 55 |
| Nhal_1678 | YP_003527193.1 | mercuric transporter periplasmic component | BAC0674 | Protein | 3e-11 | 52 |
| Nhal_1678 | YP_003527193.1 | mercuric transporter periplasmic component | BAC0679 | Protein | 2e-11 | 52 |
| Nhal_1678 | YP_003527193.1 | mercuric transporter periplasmic component | BAC0231 | Protein | 7e-11 | 49 |
| Nhal_1678 | YP_003527193.1 | mercuric transporter periplasmic component | BAC0678 | Protein | 6e-11 | 49 |