Gene Information

Name : Amico_1683 (Amico_1683)
Accession : YP_003554523.1
Strain : Aminobacterium colombiense DSM 12261
Genome accession: NC_014011
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1725318 - 1726016 bp
Length : 699 bp
Strand : +
Note : KEGG: gsu:GSU1102 DNA-binding response regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver

DNA sequence :
GTGAGCGGCGATCGAATTCTTATTGTAGATGATGAAAAGGGAATACAGGATATTGTCTCACAGGCGCTGAAAAGACGGGG
ATACGAAACAATATGCGCCAGCGATGGAGACTCTGCTCTTGATCTTGCCTTCGCCGCCCATCCAGATCTTATTATCCTCG
ACCTTATGCTCCCCCGTATGGATGGCTGGGAAGTCTGCCGCCGTCTAAAAAGCAACAAAGAGACAGCCCTGATCCCCATT
ATTATGCTCACCGCCCGCCGGGATGAGATGGATGTAGTAGAGGGGCTGGAACTTGGCGCGGATGATTATATGAAAAAACC
TTTTTCCCTGGCAGAACTTGTAGCCCGCGTGGGCGTATTGCTGCGCCGAACCAGAATGACAGAAGAGACAAGGCAGATCA
CTAACGGCGATCTTGTTATGGACATCGAAAACCAATGGGTCATGCTGCGAGGCAACAGCCTCGATCTCAGCCCCACTGAA
TTTCGTCTTCTTGAACTTCTCGCCCACCGCTTCGGACGAACTGTAAGCAGAGACGAGCTGCTGGGAAGAATCTGGAACCT
CTATGGAGGGGACACTCGCACTGTGGATGTGCATATTTCACGGCTTCGAAAAAAACTGGACGACAATAAACACCCGGCGC
TCCTCATTCAGACGCTCCGGGGCAGAGGGTACAGGATCACATGGGAGGATAAACCATGA

Protein sequence :
MSGDRILIVDDEKGIQDIVSQALKRRGYETICASDGDSALDLAFAAHPDLIILDLMLPRMDGWEVCRRLKSNKETALIPI
IMLTARRDEMDVVEGLELGADDYMKKPFSLAELVARVGVLLRRTRMTEETRQITNGDLVMDIENQWVMLRGNSLDLSPTE
FRLLELLAHRFGRTVSRDELLGRIWNLYGGDTRTVDVHISRLRKKLDDNKHPALLIQTLRGRGYRITWEDKP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-30 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 8e-30 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Amico_1683 YP_003554523.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 2e-41 46
Amico_1683 YP_003554523.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-41 46
Amico_1683 YP_003554523.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-41 46
Amico_1683 YP_003554523.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 2e-41 46
Amico_1683 YP_003554523.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-41 46
Amico_1683 YP_003554523.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 2e-41 46
Amico_1683 YP_003554523.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-41 46
Amico_1683 YP_003554523.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-41 46
Amico_1683 YP_003554523.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-41 46
Amico_1683 YP_003554523.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-41 46
Amico_1683 YP_003554523.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 6e-39 46
Amico_1683 YP_003554523.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 5e-34 45
Amico_1683 YP_003554523.1 winged helix family two component transcriptional regulator BAC0197 Protein 3e-26 43
Amico_1683 YP_003554523.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 2e-31 42
Amico_1683 YP_003554523.1 winged helix family two component transcriptional regulator BAC0308 Protein 1e-30 42
Amico_1683 YP_003554523.1 winged helix family two component transcriptional regulator CP000675.2.gene1535. Protein 2e-33 41
Amico_1683 YP_003554523.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 5e-32 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Amico_1683 YP_003554523.1 winged helix family two component transcriptional regulator VFG0596 Protein 2e-30 43
Amico_1683 YP_003554523.1 winged helix family two component transcriptional regulator VFG1389 Protein 1e-26 42