Gene Information

Name : BMQ_3345 (BMQ_3345)
Accession : YP_003563801.1
Strain : Bacillus megaterium QM B1551
Genome accession: NC_014019
Putative virulence/resistance : Resistance
Product : hypothetical protein
Function : -
COG functional category : S : Function unknown
COG ID : COG1937
EC number : -
Position : 3260872 - 3261132 bp
Length : 261 bp
Strand : -
Note : -

DNA sequence :
ATGGAGTATAACCAACAAGTGAAAAATCGCCTGCGCCGAATTGAAGGGCAGCTAAAAGGTGTGCTCAGCATGATGGAGCA
AGAAAAAGACTGCCGAGACGTCGTGACTCAATTATCCGCTGCAAGAAGTGCTATTGATCGCACAATGGGAGTCATTGTGA
GCAGCAATCTTGAACAGTGCGTCAGAGAGAGCCTTCAGCAAGGAGAGCCAACGGCAGGGCTAGTGCAAGAAGCTGTACAG
TTATTAGTAAAAAGCCGCTAA

Protein sequence :
MEYNQQVKNRLRRIEGQLKGVLSMMEQEKDCRDVVTQLSAARSAIDRTMGVIVSSNLEQCVRESLQQGEPTAGLVQEAVQ
LLVKSR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
SACOL0048 YP_184958.1 hypothetical protein Not tested Type-I SCCmec Protein 2e-21 54
unnamed BAB83476.1 - Not tested SCC 12263 Protein 2e-19 54
unnamed BAA94324.1 hypothetical protein Not tested Type-I SCCmec Protein 2e-19 54
SAPIG0063 YP_005732873.1 conserved protein YrkD Not tested Type-V SCCmec Protein 2e-21 53
unnamed BAC57484.1 hypothetical protein Not tested Type-IIIinv SCCmec Protein 3e-21 52
SERP2514 YP_190056.1 hypothetical protein Not tested Type-II SCCmec Protein 4e-21 52
unnamed BAA82210.2 - Not tested Type-II SCCmec Protein 3e-21 52
SAV0048 NP_370572.1 hypothetical protein Not tested Type-II SCCmec Protein 4e-21 52
SA0045 NP_373285.1 hypothetical protein Not tested Type-II SCCmec Protein 4e-21 52
SAR0047 YP_039520.1 hypothetical protein Not tested Type-II SCCmec Protein 4e-21 52
unnamed BAB47614.1 hypothetical protein Not tested Type-III SCCmec Protein 3e-21 52
unnamed BAA82170.2 - Not tested Type-II SCCmec Protein 2e-20 49
unnamed BAA86632.1 hypothetical protein Not tested Type-I SCCmec Protein 8e-21 49

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BMQ_3345 YP_003563801.1 hypothetical protein BAC0333 Protein 1e-08 42