Gene Information

Name : Btus_1925 (Btus_1925)
Accession : YP_003589765.1
Strain : Kyrpidia tusciae DSM 2912
Genome accession: NC_014098
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1934127 - 1934813 bp
Length : 687 bp
Strand : -
Note : KEGG: gtn:GTNG_0183 response regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver

DNA sequence :
ATGGAAGCGATGCTCTTGCTGGTGGACGATGAACCGCGGGTCCTGGACGTCATGGCGACGTTCCTGCAGGGGGAGGGGTT
CCGAATCGTTACCGCCCAAACCGGCCGGGAGGCTTTGGAGGTTTTTCAAAAACATCAGCCCGACCTTGTGGTCCTGGACT
GGATGTTGCCCGAGATGAGCGGACTCGATGTCTGTCGGGAGCTGCGCCGGATGGGCAGCGTGGGCATCATCATGGTGACG
GCCCGGACGGAAGAGGCGGATAAGATCGTCGGCCTTGAGGTGGGAGCCGATGATTACATCACCAAACCCTTCAGCCTGCG
GGAATTGGCTGCCCGAATTCGCTCGGTGTTGCGGCGCACCCAGGGGGGCGGGGATGAGCCTTCGGTGCTGCGCCGGGGTG
ATTTGACGATCGACGAGACGAAATTCCGGGTGTGGAAAGGGGATCAGGAGATCGTTCTCACCCCGACGGAGTTCAAAATT
CTCGTGACCCTCGCTTCCAGGCCGGGAACGGTTTACAGCCGTTTGCAACTGTTACAAAGCGCCCTGGGGGAGACTTACCT
CAACTACGAGCGAACGGTGGATACTCATGTCAGCCATTTGAGGAAAAAAATTGAAGATGATCCCGCGGAACCGCGCTATA
TTCAAACGGTATATGGGGTCGGATACCGATTCGGTGAGCGCCTGTGA

Protein sequence :
MEAMLLLVDDEPRVLDVMATFLQGEGFRIVTAQTGREALEVFQKHQPDLVVLDWMLPEMSGLDVCRELRRMGSVGIIMVT
ARTEEADKIVGLEVGADDYITKPFSLRELAARIRSVLRRTQGGGDEPSVLRRGDLTIDETKFRVWKGDQEIVLTPTEFKI
LVTLASRPGTVYSRLQLLQSALGETYLNYERTVDTHVSHLRKKIEDDPAEPRYIQTVYGVGYRFGERL

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 3e-38 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 8e-38 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Btus_1925 YP_003589765.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 9e-42 46
Btus_1925 YP_003589765.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 8e-41 46
Btus_1925 YP_003589765.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 1e-37 42
Btus_1925 YP_003589765.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 1e-35 42
Btus_1925 YP_003589765.1 winged helix family two component transcriptional regulator CP000034.1.gene3671. Protein 6e-39 42
Btus_1925 YP_003589765.1 winged helix family two component transcriptional regulator CP000647.1.gene2531. Protein 5e-44 42
Btus_1925 YP_003589765.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 2e-37 41
Btus_1925 YP_003589765.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 1e-37 41
Btus_1925 YP_003589765.1 winged helix family two component transcriptional regulator NC_010410.6002989.p0 Protein 2e-42 41
Btus_1925 YP_003589765.1 winged helix family two component transcriptional regulator NC_011595.7057856.p0 Protein 2e-42 41
Btus_1925 YP_003589765.1 winged helix family two component transcriptional regulator NC_010400.5986590.p0 Protein 1e-42 41
Btus_1925 YP_003589765.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-37 41
Btus_1925 YP_003589765.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-37 41
Btus_1925 YP_003589765.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-37 41
Btus_1925 YP_003589765.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-37 41
Btus_1925 YP_003589765.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-37 41
Btus_1925 YP_003589765.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-37 41
Btus_1925 YP_003589765.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-37 41
Btus_1925 YP_003589765.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-37 41
Btus_1925 YP_003589765.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-37 41
Btus_1925 YP_003589765.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 3e-35 41
Btus_1925 YP_003589765.1 winged helix family two component transcriptional regulator BAC0039 Protein 1e-42 41
Btus_1925 YP_003589765.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 5e-42 41
Btus_1925 YP_003589765.1 winged helix family two component transcriptional regulator CP001918.1.gene3444. Protein 1e-42 41
Btus_1925 YP_003589765.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 1e-42 41
Btus_1925 YP_003589765.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 8e-43 41
Btus_1925 YP_003589765.1 winged helix family two component transcriptional regulator BAC0596 Protein 5e-42 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Btus_1925 YP_003589765.1 winged helix family two component transcriptional regulator VFG1563 Protein 2e-38 42
Btus_1925 YP_003589765.1 winged helix family two component transcriptional regulator VFG1702 Protein 3e-38 42
Btus_1925 YP_003589765.1 winged helix family two component transcriptional regulator VFG1386 Protein 9e-31 41