Gene Information

Name : BMD_2587 (BMD_2587)
Accession : YP_003597782.1
Strain : Bacillus megaterium DSM 319
Genome accession: NC_014103
Putative virulence/resistance : Resistance
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2565435 - 2566118 bp
Length : 684 bp
Strand : -
Note : -

DNA sequence :
ATGAAGAAGATATTATTAATTGAAGATGAAGTAAGTATTGCTGAATTGCAAAGAGATTATTTAGAAATTAACGATTTTGA
AATAGACGTTCAATATAGCGGGGATAAGGGATTAGAAAAAGCGTTAAATGAACATTTTGATCTGGTTATTTTGGATATTA
TGCTCCCTAAAGTAAGCGGATTTGAAGTGTGCAAGCAAATTCGAGCTGCAAAAGATATTCCAATCATTTTAGTTTCAGCT
AAAAAAGAAGAAATTGATAAAATTAGAGGGCTCGGGCTAGGTGCAGATGACTATATTACCAAGCCATTCAGCCCTGGGGA
GCTGGTCGCAAGAGTCAAAGCGCATTTAGCGAGATATGAAAGACTCTCTGATAAGCAGGAAAAGCGTATGATTCACATTC
ATGGCTTAGCGATTGACACGCTCGCTAGAAGAGTATTTGTGAATGACAAAGAAGTGTTTTTTACAGCGAAGGAATTTGAT
TTGCTGAAGTTTATCGTTTCTCATCCAAATCAAGTATTAAGTAAAGAACATCTATTTGAAAAAATTTGGGGATTTGATTC
TTCAGGAGATATTTCAACCGTAACAGTTCACATTCGAAAACTAAGAGAAAAGTTAGAAGAAAACCCAGCAGATCCTCAGT
ACCTAGAAACGGTTTGGGGAGCAGGGTACCGGTTTAATATTTAA

Protein sequence :
MKKILLIEDEVSIAELQRDYLEINDFEIDVQYSGDKGLEKALNEHFDLVILDIMLPKVSGFEVCKQIRAAKDIPIILVSA
KKEEIDKIRGLGLGADDYITKPFSPGELVARVKAHLARYERLSDKQEKRMIHIHGLAIDTLARRVFVNDKEVFFTAKEFD
LLKFIVSHPNQVLSKEHLFEKIWGFDSSGDISTVTVHIRKLREKLEENPADPQYLETVWGAGYRFNI

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-42 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-41 41
sboR YP_006309915.1 SboR Not tested FWisland_1 Protein 7e-30 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BMD_2587 YP_003597782.1 two-component response regulator NC_012469.1.7686381. Protein 7e-42 44
BMD_2587 YP_003597782.1 two-component response regulator NC_005054.2598277.p0 Protein 2e-45 43
BMD_2587 YP_003597782.1 two-component response regulator NC_014475.1.orf0.gen Protein 2e-45 43
BMD_2587 YP_003597782.1 two-component response regulator FJ349556.1.orf0.gene Protein 3e-41 43
BMD_2587 YP_003597782.1 two-component response regulator AF155139.2.orf0.gene Protein 5e-42 43
BMD_2587 YP_003597782.1 two-component response regulator AM180355.1.gene1830. Protein 3e-42 43
BMD_2587 YP_003597782.1 two-component response regulator NC_002952.2859905.p0 Protein 1e-43 42
BMD_2587 YP_003597782.1 two-component response regulator NC_007622.3794472.p0 Protein 1e-43 42
BMD_2587 YP_003597782.1 two-component response regulator NC_002758.1121668.p0 Protein 1e-43 42
BMD_2587 YP_003597782.1 two-component response regulator NC_009641.5332272.p0 Protein 1e-43 42
BMD_2587 YP_003597782.1 two-component response regulator NC_013450.8614421.p0 Protein 1e-43 42
BMD_2587 YP_003597782.1 two-component response regulator AF130997.1.orf0.gene Protein 2e-38 42
BMD_2587 YP_003597782.1 two-component response regulator NC_007793.3914279.p0 Protein 1e-43 42
BMD_2587 YP_003597782.1 two-component response regulator NC_003923.1003749.p0 Protein 1e-43 42
BMD_2587 YP_003597782.1 two-component response regulator NC_002745.1124361.p0 Protein 1e-43 42
BMD_2587 YP_003597782.1 two-component response regulator NC_009782.5559369.p0 Protein 1e-43 42
BMD_2587 YP_003597782.1 two-component response regulator NC_002951.3237708.p0 Protein 1e-43 42
BMD_2587 YP_003597782.1 two-component response regulator AE016830.1.gene1681. Protein 2e-41 42
BMD_2587 YP_003597782.1 two-component response regulator NC_012469.1.7685629. Protein 4e-41 42
BMD_2587 YP_003597782.1 two-component response regulator EU250284.1.orf4.gene Protein 4e-41 42
BMD_2587 YP_003597782.1 two-component response regulator DQ212986.1.gene4.p01 Protein 3e-39 42
BMD_2587 YP_003597782.1 two-component response regulator HE999704.1.gene2815. Protein 3e-38 42
BMD_2587 YP_003597782.1 two-component response regulator NC_003923.1003417.p0 Protein 1e-40 41
BMD_2587 YP_003597782.1 two-component response regulator NC_013450.8614146.p0 Protein 1e-40 41
BMD_2587 YP_003597782.1 two-component response regulator NC_002951.3238224.p0 Protein 1e-40 41
BMD_2587 YP_003597782.1 two-component response regulator NC_007793.3914065.p0 Protein 1e-40 41
BMD_2587 YP_003597782.1 two-component response regulator NC_002758.1121390.p0 Protein 1e-40 41
BMD_2587 YP_003597782.1 two-component response regulator NC_010079.5776364.p0 Protein 1e-40 41
BMD_2587 YP_003597782.1 two-component response regulator NC_002952.2859858.p0 Protein 1e-40 41
BMD_2587 YP_003597782.1 two-component response regulator NC_007622.3794948.p0 Protein 1e-40 41
BMD_2587 YP_003597782.1 two-component response regulator AF162694.1.orf4.gene Protein 2e-41 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BMD_2587 YP_003597782.1 two-component response regulator VFG1563 Protein 1e-42 41
BMD_2587 YP_003597782.1 two-component response regulator VFG1702 Protein 7e-42 41