Gene Information

Name : BMD_5012 (BMD_5012)
Accession : YP_003600162.1
Strain : Bacillus megaterium DSM 319
Genome accession: NC_014103
Putative virulence/resistance : Virulence
Product : two-component response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4826457 - 4827182 bp
Length : 726 bp
Strand : -
Note : -

DNA sequence :
ATGAAAGAGAAAATTTTAATTGTGGAAGATGAAGCGCAAATTGCGAAAGTGTTAAAAATTGAATTGGAATTTGAAGATTA
TGAAGTAGATGTTGAGTACGACGGGAAAGCGGGGTTAGAGACGGCAACATCCGCTCAATATGACCTCATTTTGCTAGACG
TGATGCTTCCAAGTCTGAGCGGTATTGAGGTGTTAAGAAGACTTCGGAAAGCGGAAGTATTTACGCCAGTTATTTTATTA
ACTGCCCGAAATACGACGCTAGATAAGGTAATGGGATTAGACCAAGGGGCTAATGATTATGTGACAAAACCGTTTGAAAT
TGAAGAGCTGTTAGCACGGGTTCGCTCTTGTATTCGCTATCGTTCGCTCGTAGAAGCATCAGGAACGAAAGAAGCTGAAG
CAGAGCTCTTAACGATCAGTGATTTGACCATTAATCTTGAAACAAGGGAAGTCCTAAGAAACAATGAATCCATTACGTTG
ACACCGAAAGAGTATGATTTAGTCGTGTATTTGCTTACGAATAAAAATAAAATTGTCACGAGAGAAGGAATTCTCACAAA
CGTTTGGGGCTATGAATATGAAGGAGAAACGAACGTAATTGATGTGTATATTCGCCACTTAAGAAAAAAAGTAGATGAAG
GTTTTTCTACTTCTCTCATTCATACAGTGCGAGGCGTAGGATATATGATGAAAGAGGAGAAACATGAAGATCACGACGAA
GATTAA

Protein sequence :
MKEKILIVEDEAQIAKVLKIELEFEDYEVDVEYDGKAGLETATSAQYDLILLDVMLPSLSGIEVLRRLRKAEVFTPVILL
TARNTTLDKVMGLDQGANDYVTKPFEIEELLARVRSCIRYRSLVEASGTKEAEAELLTISDLTINLETREVLRNNESITL
TPKEYDLVVYLLTNKNKIVTREGILTNVWGYEYEGETNVIDVYIRHLRKKVDEGFSTSLIHTVRGVGYMMKEEKHEDHDE
D

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 4e-36 47
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-35 44

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BMD_5012 YP_003600162.1 two-component response regulator HE999704.1.gene1528. Protein 2e-39 50
BMD_5012 YP_003600162.1 two-component response regulator NC_013450.8614146.p0 Protein 4e-40 49
BMD_5012 YP_003600162.1 two-component response regulator NC_002951.3238224.p0 Protein 4e-40 49
BMD_5012 YP_003600162.1 two-component response regulator NC_007793.3914065.p0 Protein 4e-40 49
BMD_5012 YP_003600162.1 two-component response regulator NC_002758.1121390.p0 Protein 4e-40 49
BMD_5012 YP_003600162.1 two-component response regulator NC_010079.5776364.p0 Protein 4e-40 49
BMD_5012 YP_003600162.1 two-component response regulator NC_002952.2859858.p0 Protein 4e-40 49
BMD_5012 YP_003600162.1 two-component response regulator NC_007622.3794948.p0 Protein 4e-40 49
BMD_5012 YP_003600162.1 two-component response regulator NC_003923.1003417.p0 Protein 4e-40 49
BMD_5012 YP_003600162.1 two-component response regulator AE015929.1.gene1106. Protein 3e-35 47
BMD_5012 YP_003600162.1 two-component response regulator BAC0125 Protein 5e-40 43
BMD_5012 YP_003600162.1 two-component response regulator BAC0308 Protein 7e-39 43
BMD_5012 YP_003600162.1 two-component response regulator BAC0197 Protein 2e-40 43
BMD_5012 YP_003600162.1 two-component response regulator FJ349556.1.orf0.gene Protein 3e-31 43
BMD_5012 YP_003600162.1 two-component response regulator NC_002952.2859905.p0 Protein 2e-40 42
BMD_5012 YP_003600162.1 two-component response regulator NC_002758.1121668.p0 Protein 2e-40 42
BMD_5012 YP_003600162.1 two-component response regulator NC_009641.5332272.p0 Protein 2e-40 42
BMD_5012 YP_003600162.1 two-component response regulator NC_013450.8614421.p0 Protein 2e-40 42
BMD_5012 YP_003600162.1 two-component response regulator NC_007793.3914279.p0 Protein 2e-40 42
BMD_5012 YP_003600162.1 two-component response regulator NC_003923.1003749.p0 Protein 2e-40 42
BMD_5012 YP_003600162.1 two-component response regulator NC_002745.1124361.p0 Protein 2e-40 42
BMD_5012 YP_003600162.1 two-component response regulator NC_009782.5559369.p0 Protein 2e-40 42
BMD_5012 YP_003600162.1 two-component response regulator NC_002951.3237708.p0 Protein 2e-40 42
BMD_5012 YP_003600162.1 two-component response regulator NC_007622.3794472.p0 Protein 2e-40 42
BMD_5012 YP_003600162.1 two-component response regulator BAC0347 Protein 4e-35 41
BMD_5012 YP_003600162.1 two-component response regulator BAC0111 Protein 2e-37 41
BMD_5012 YP_003600162.1 two-component response regulator BAC0638 Protein 4e-35 41
BMD_5012 YP_003600162.1 two-component response regulator AF155139.2.orf0.gene Protein 6e-31 41
BMD_5012 YP_003600162.1 two-component response regulator HE999704.1.gene2815. Protein 7e-39 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BMD_5012 YP_003600162.1 two-component response regulator VFG0596 Protein 2e-36 47
BMD_5012 YP_003600162.1 two-component response regulator VFG1390 Protein 2e-38 41