Gene Information

Name : walR (BMD_5245)
Accession : YP_003600394.1
Strain : Bacillus megaterium DSM 319
Genome accession: NC_014103
Putative virulence/resistance : Virulence
Product : two-component response regulator WalR
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 5073978 - 5074685 bp
Length : 708 bp
Strand : -
Note : -

DNA sequence :
ATGGATAAACGTATTTTAGTCGTAGATGACGAAAAGCCGATTGCAGATATTTTAAAGTTTAATTTGCAAAAAGAAGGTTA
CGAAGTATTTTGTGCTTATGATGGCGTAGAAGCACTTGAAAAAGTGGAAGAAGTACAGCCTGAAATGATTTTATTAGATA
TTATGCTTCCTCAGAAAGATGGAATGGAAGTTTGCCGAGAAGTGCGCAAAAAATATGATATGCCAATTATCATGTTAACA
GCAAAAGACTCTGAAATTGACAAAGTTTTAGGTCTAGAATTGGGTGCAGATGATTATGTAACTAAGCCGTTTAGTACGCG
TGAATTATTAGCACGTGTAAAAGCTAATTTACGTAGACATCAGCAGGTAGCTGTTCCAACGGAAGAAAGCGAAACGAATG
AAATTACGATTGGAGCACTTGTTATTCACCCAGATGCCTATATCGTGTCTAAGCGCGGAGAAACGATTGAACTGACTCAC
CGTGAATTTGAGCTGCTGCATTATTTAGCGAAGCACATTGGACAAGTCATGACGCGTGAACACTTGCTTCAAACTGTATG
GGGTTATGACTATTTTGGTGATGTGCGTACGGTAGATGTAACAGTTCGAAGATTACGTGAAAAAATTGAAGATAATCCAA
GCCATCCAATGTGGATTGTAACAAGACGTGGAGTAGGCTATTATTTACGCAGCCCAGAGCAGGAGTAA

Protein sequence :
MDKRILVVDDEKPIADILKFNLQKEGYEVFCAYDGVEALEKVEEVQPEMILLDIMLPQKDGMEVCREVRKKYDMPIIMLT
AKDSEIDKVLGLELGADDYVTKPFSTRELLARVKANLRRHQQVAVPTEESETNEITIGALVIHPDAYIVSKRGETIELTH
REFELLHYLAKHIGQVMTREHLLQTVWGYDYFGDVRTVDVTVRRLREKIEDNPSHPMWIVTRRGVGYYLRSPEQE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-32 41
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-32 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
walR YP_003600394.1 two-component response regulator WalR NC_012469.1.7685629. Protein 7e-67 68
walR YP_003600394.1 two-component response regulator WalR NC_002952.2859905.p0 Protein 2e-55 57
walR YP_003600394.1 two-component response regulator WalR NC_013450.8614421.p0 Protein 1e-55 56
walR YP_003600394.1 two-component response regulator WalR NC_007793.3914279.p0 Protein 1e-55 56
walR YP_003600394.1 two-component response regulator WalR NC_007622.3794472.p0 Protein 9e-56 56
walR YP_003600394.1 two-component response regulator WalR NC_002745.1124361.p0 Protein 1e-55 56
walR YP_003600394.1 two-component response regulator WalR NC_009782.5559369.p0 Protein 1e-55 56
walR YP_003600394.1 two-component response regulator WalR NC_002951.3237708.p0 Protein 1e-55 56
walR YP_003600394.1 two-component response regulator WalR NC_003923.1003749.p0 Protein 1e-55 56
walR YP_003600394.1 two-component response regulator WalR NC_002758.1121668.p0 Protein 1e-55 56
walR YP_003600394.1 two-component response regulator WalR NC_009641.5332272.p0 Protein 1e-55 56
walR YP_003600394.1 two-component response regulator WalR HE999704.1.gene2815. Protein 1e-45 51
walR YP_003600394.1 two-component response regulator WalR NC_012469.1.7686381. Protein 1e-41 50
walR YP_003600394.1 two-component response regulator WalR AE016830.1.gene1681. Protein 8e-45 47
walR YP_003600394.1 two-component response regulator WalR AM180355.1.gene1830. Protein 3e-40 46
walR YP_003600394.1 two-component response regulator WalR FJ349556.1.orf0.gene Protein 9e-40 46
walR YP_003600394.1 two-component response regulator WalR HE999704.1.gene1528. Protein 2e-30 44
walR YP_003600394.1 two-component response regulator WalR AF155139.2.orf0.gene Protein 2e-36 44
walR YP_003600394.1 two-component response regulator WalR AE000516.2.gene3505. Protein 4e-37 43
walR YP_003600394.1 two-component response regulator WalR NC_003923.1003417.p0 Protein 6e-35 43
walR YP_003600394.1 two-component response regulator WalR NC_013450.8614146.p0 Protein 6e-35 43
walR YP_003600394.1 two-component response regulator WalR NC_002951.3238224.p0 Protein 6e-35 43
walR YP_003600394.1 two-component response regulator WalR NC_007793.3914065.p0 Protein 6e-35 43
walR YP_003600394.1 two-component response regulator WalR NC_002758.1121390.p0 Protein 6e-35 43
walR YP_003600394.1 two-component response regulator WalR NC_010079.5776364.p0 Protein 6e-35 43
walR YP_003600394.1 two-component response regulator WalR NC_002952.2859858.p0 Protein 6e-35 43
walR YP_003600394.1 two-component response regulator WalR NC_007622.3794948.p0 Protein 6e-35 43
walR YP_003600394.1 two-component response regulator WalR CP000034.1.gene2186. Protein 6e-30 43
walR YP_003600394.1 two-component response regulator WalR BAC0039 Protein 6e-30 43
walR YP_003600394.1 two-component response regulator WalR NC_002695.1.916589.p Protein 5e-30 43
walR YP_003600394.1 two-component response regulator WalR AF130997.1.orf0.gene Protein 2e-37 42
walR YP_003600394.1 two-component response regulator WalR NC_014475.1.orf0.gen Protein 3e-38 42
walR YP_003600394.1 two-component response regulator WalR NC_005054.2598277.p0 Protein 3e-38 42
walR YP_003600394.1 two-component response regulator WalR BAC0533 Protein 3e-32 42
walR YP_003600394.1 two-component response regulator WalR NC_002695.1.915041.p Protein 2e-32 42
walR YP_003600394.1 two-component response regulator WalR CP000647.1.gene4257. Protein 3e-32 42
walR YP_003600394.1 two-component response regulator WalR CP000034.1.gene3834. Protein 2e-32 42
walR YP_003600394.1 two-component response regulator WalR AF162694.1.orf4.gene Protein 3e-34 42
walR YP_003600394.1 two-component response regulator WalR DQ212986.1.gene4.p01 Protein 2e-39 42
walR YP_003600394.1 two-component response regulator WalR CP001918.1.gene5135. Protein 1e-27 42
walR YP_003600394.1 two-component response regulator WalR CP004022.1.gene3215. Protein 3e-35 42
walR YP_003600394.1 two-component response regulator WalR CP001138.1.gene2239. Protein 2e-28 42
walR YP_003600394.1 two-component response regulator WalR BAC0596 Protein 2e-28 42
walR YP_003600394.1 two-component response regulator WalR CP001918.1.gene3444. Protein 9e-29 42
walR YP_003600394.1 two-component response regulator WalR CP000647.1.gene2531. Protein 7e-29 42
walR YP_003600394.1 two-component response regulator WalR CP001485.1.gene721.p Protein 2e-28 41
walR YP_003600394.1 two-component response regulator WalR CP001138.1.gene4273. Protein 5e-32 41
walR YP_003600394.1 two-component response regulator WalR EU250284.1.orf4.gene Protein 2e-35 41
walR YP_003600394.1 two-component response regulator WalR AE015929.1.gene1106. Protein 6e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
walR YP_003600394.1 two-component response regulator WalR VFG1389 Protein 1e-29 44
walR YP_003600394.1 two-component response regulator WalR VFG1390 Protein 8e-36 43
walR YP_003600394.1 two-component response regulator WalR VFG1563 Protein 8e-33 41
walR YP_003600394.1 two-component response regulator WalR VFG1702 Protein 1e-32 41