Gene Information

Name : BC1002_2557 (BC1002_2557)
Accession : YP_003606117.1
Strain :
Genome accession: NC_014117
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2849149 - 2849946 bp
Length : 798 bp
Strand : +
Note : KEGG: bxe:Bxe_A0670 two component transcriptional regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver

DNA sequence :
ATGCGAATTCTGATTGCCGAAGACGACAGCATACTCGCGGACGGTCTGGTTCGATCACTCCGCCAATCGGCCTATGCGGT
CGATCACGTCAAAAGCGGCGTAGAAGCCGATACCGCGTTGTCAATGCAGACGTTCGACCTATTGATCCTCGATCTGGGCC
TGCCGCGCATGTCCGGGCTCGAGGTGCTGCGCCGCCTGCGGGCGCGCAATTCGAACCTGCCGGTGCTGATCCTGACCGCC
GCAGACAGCGTCGACGAACGCGTCAAAGGCCTCGATCTCGGCGCCGACGATTACATGGCCAAGCCCTTCGCGCTGAACGA
ACTCGAAGCGCGCGTGCGCGCGCTGACGCGGCGCGGCGCCGGCGGCGGCCCGACCGTCGTGCGGCATGGCTCGCTGTCGT
TCGATCAGGTGGGCCGCATCGCCTATGTCAACGACCAGGTGATCGACCTCTCCGCACGCGAGCTCGGTCTGCTCGAAGTG
CTGCTGCAACGGATCGGCCGGCTGGTCTCGAAAGAGCAGTTGGTCGACCATCTGTGCGAATGGGGCGAGGAAGTCAGCAA
CAACGCGATCGAAGTCTACGTGCACCGGCTGCGCAAGAAGATCGAGCCGAGCGGCGTGCGCATCATCACCGTGCGCGGGC
TCGGCTACTGCCTCGAAAAGGCGGCGCCGCCGGCAAATGCGAACGCGCCCGCTGCCCCTGCCGGCTCCGAGTCGCAAACG
GCACAAGCGGCACAAACGGCACCACCGTCCACCGCGCCGTCGTCCGCCGCGATGCCGGCGAGCCATCACTACAAATAG

Protein sequence :
MRILIAEDDSILADGLVRSLRQSAYAVDHVKSGVEADTALSMQTFDLLILDLGLPRMSGLEVLRRLRARNSNLPVLILTA
ADSVDERVKGLDLGADDYMAKPFALNELEARVRALTRRGAGGGPTVVRHGSLSFDQVGRIAYVNDQVIDLSARELGLLEV
LLQRIGRLVSKEQLVDHLCEWGEEVSNNAIEVYVHRLRKKIEPSGVRIITVRGLGYCLEKAAPPANANAPAAPAGSESQT
AQAAQTAPPSTAPSSAAMPASHHYK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
armR AAN62112.1 putative response-regulator ArmR Not tested PAGI-2(C) Protein 1e-38 45

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BC1002_2557 YP_003606117.1 two component transcriptional regulator, winged helix family BAC0487 Protein 1e-36 44
BC1002_2557 YP_003606117.1 two component transcriptional regulator, winged helix family BAC0083 Protein 6e-36 44
BC1002_2557 YP_003606117.1 two component transcriptional regulator, winged helix family BAC0638 Protein 2e-29 44
BC1002_2557 YP_003606117.1 two component transcriptional regulator, winged helix family NC_002516.2.879194.p Protein 3e-31 42
BC1002_2557 YP_003606117.1 two component transcriptional regulator, winged helix family BAC0347 Protein 9e-33 41
BC1002_2557 YP_003606117.1 two component transcriptional regulator, winged helix family CP000647.1.gene1136. Protein 1e-28 41
BC1002_2557 YP_003606117.1 two component transcriptional regulator, winged helix family BAC0308 Protein 9e-31 41
BC1002_2557 YP_003606117.1 two component transcriptional regulator, winged helix family CP001138.1.gene1939. Protein 4e-29 41
BC1002_2557 YP_003606117.1 two component transcriptional regulator, winged helix family BAC0530 Protein 1e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
BC1002_2557 YP_003606117.1 two component transcriptional regulator, winged helix family VFG1390 Protein 2e-35 44
BC1002_2557 YP_003606117.1 two component transcriptional regulator, winged helix family VFG0473 Protein 2e-40 44
BC1002_2557 YP_003606117.1 two component transcriptional regulator, winged helix family VFG0475 Protein 3e-29 41