Gene Information

Name : pcoR (ECL_04877)
Accession : YP_003615352.1
Strain : Enterobacter cloacae ATCC 13047
Genome accession: NC_014121
Putative virulence/resistance : Virulence
Product : two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 4985239 - 4985919 bp
Length : 681 bp
Strand : -
Note : -

DNA sequence :
ATGCAGCGTATTTTAATCGTTGAAGACGAACAAAAAACAGGTCGTTACCTGCAGCAGGGACTGGTTGAGGAAGGCTATCA
GGCCGATCTCTTTAATAATGGCCGCGATGGTCTCGGGGCCGCGTCGAAGGGACAGTATGATTTGATAATACTGGACGTGA
TGCTGCCTTTCCTCGACGGGTGGCAAATCATCAGCGCACTGAGGGAGTCCGGGCACGAAGAACCGGTCCTGTTTTTAACC
GCAAAGGACAACGTGCGGGACAAAGTGAAAGGACTGGAGCTTGGCGCAGATGACTACCTGATTAAGCCCTTTGATTTTAC
GGAGCTGGTTGCACGTGTAAGAACCCTACTGCGCCGGGCACGCTCGCAGGCCGCAACAGTCTGCACCATCGCCGATATGA
CCGTTGATATGGTGCGCCGGACCGTGATCCGTTCGGGGAAGAAGATCCATCTCACCGGTAAAGAATACGTTCTGCTTGAG
TTGCTGCTGCAACGCACCGGAGAAGTGTTACCCAGGAGTCTTATCTCGTCCCTGGTCTGGAACATGAATTTTGACAGTGA
TACGAATGTGATTGATGTCGCCGTGAGACGTCTGAGAAGTAAAATTGATGATGACTTTGAGCCAAAACTGATCCATACCG
TTCGCGGTGCCGGATATGTCCTGGAGATCAGAGAAGAGTGA

Protein sequence :
MQRILIVEDEQKTGRYLQQGLVEEGYQADLFNNGRDGLGAASKGQYDLIILDVMLPFLDGWQIISALRESGHEEPVLFLT
AKDNVRDKVKGLELGADDYLIKPFDFTELVARVRTLLRRARSQAATVCTIADMTVDMVRRTVIRSGKKIHLTGKEYVLLE
LLLQRTGEVLPRSLISSLVWNMNFDSDTNVIDVAVRRLRSKIDDDFEPKLIHTVRGAGYVLEIREE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-49 55
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-48 54

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
pcoR YP_003615352.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR BAC0308 Protein 1e-95 100
pcoR YP_003615352.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR BAC0638 Protein 1e-55 64
pcoR YP_003615352.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR BAC0197 Protein 9e-60 63
pcoR YP_003615352.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR BAC0083 Protein 4e-59 62
pcoR YP_003615352.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR BAC0111 Protein 6e-57 60
pcoR YP_003615352.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR BAC0125 Protein 6e-55 58
pcoR YP_003615352.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR BAC0347 Protein 1e-49 55
pcoR YP_003615352.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR NC_002951.3238224.p0 Protein 2e-30 44
pcoR YP_003615352.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR NC_007793.3914065.p0 Protein 2e-30 44
pcoR YP_003615352.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR NC_002758.1121390.p0 Protein 2e-30 44
pcoR YP_003615352.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR NC_010079.5776364.p0 Protein 2e-30 44
pcoR YP_003615352.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR NC_002952.2859858.p0 Protein 2e-30 44
pcoR YP_003615352.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR NC_007622.3794948.p0 Protein 2e-30 44
pcoR YP_003615352.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR NC_003923.1003417.p0 Protein 2e-30 44
pcoR YP_003615352.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR NC_013450.8614146.p0 Protein 2e-30 44
pcoR YP_003615352.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR AE015929.1.gene1106. Protein 2e-25 42
pcoR YP_003615352.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR HE999704.1.gene1528. Protein 2e-31 42

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
pcoR YP_003615352.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR VFG0596 Protein 6e-50 55
pcoR YP_003615352.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR VFG1390 Protein 6e-35 44
pcoR YP_003615352.1 two-component system, OmpR family, copper resistance phosphate regulon response regulator CusR VFG1389 Protein 2e-29 42