Gene Information

Name : ECL_00483 (ECL_00483)
Accession : YP_003610998.1
Strain : Enterobacter cloacae ATCC 13047
Genome accession: NC_014121
Putative virulence/resistance : Unknown
Product : hypothetical protein
Function : -
COG functional category : L : Replication, recombination and repair
COG ID : COG2963
EC number : -
Position : 487409 - 487681 bp
Length : 273 bp
Strand : -
Note : -

DNA sequence :
ATGAACAAGAAAACCAAACGAACCTTCCCCCCTGAGTTCAGGCTGGAATGTGCACAGCTGATTGTTGATAAGGGCTACTC
ATATCGACAGGCCAGTGAAGCGATGAATGTCGGTTCAACCACGCTTGAGAGCTGGGTACGCCAGCTCAGGCGAGAGCGCC
AGGGGGATTACGCCCTCTGCCACACCCATTACTCCAGACCAGCAACGTATCCGCGAGCTGGAAAGCAAGTTCGCCGTCTG
GAGGAACGAAAATACGATATTAAAAAAGGCTAA

Protein sequence :
MNKKTKRTFPPEFRLECAQLIVDKGYSYRQASEAMNVGSTTLESWVRQLRRERQGDYALCHTHYSRPATYPRAGKQVRRL
EERKYDIKKG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed ACU09431.1 IS911 transposase orfA Not tested LEE Protein 7e-24 72
ECO111_3778 YP_003236113.1 putative IS602 transposase OrfA Not tested LEE Protein 9e-24 72
aec66 AAW51749.1 Aec66 Not tested AGI-3 Protein 6e-24 72
Z5088 NP_290240.1 hypothetical protein Not tested LEE Protein 6e-24 72
ECs4535 NP_312562.1 hypothetical protein Not tested LEE Protein 6e-24 72
unnamed AAC31483.1 L0004 Not tested LEE Protein 4e-24 72
VPI2_0009c ACA01826.1 transposase OrfAB subunit A Not tested VPI-2 Protein 7e-15 44
orfA AGK06911.1 IS1359 transposase; OrfA Not tested SGI1 Protein 7e-15 44
unnamed AGK06948.1 IS1359 transposase; OrfA Not tested SGI1 Protein 7e-15 44
VC1790 NP_231425.1 transposase OrfAB subunit A Not tested VPI-2 Protein 1e-14 44
orfA AGK06994.1 IS1359 transposase; OrfA Not tested SGI1 Protein 7e-15 44
orfA YP_001217330.1 transposase OrfAB subunit A Not tested VPI-2 Protein 1e-14 44
orfA AGK07052.1 IS1359 transposase; OrfA Not tested SGI1 Protein 7e-15 44
orfA ACX47959.1 IS1359 transposase; OrfA Not tested SGI1 Protein 7e-15 44

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
ECL_00483 YP_003610998.1 hypothetical protein VFG0784 Protein 2e-24 72
ECL_00483 YP_003610998.1 hypothetical protein VFG1123 Protein 3e-15 44