Gene Information

Name : merP (THI_p0010)
Accession : YP_003622579.1
Strain :
Genome accession: NC_014144
Putative virulence/resistance : Resistance
Product : Mercuric transport protein periplasmic component precursor (Periplasmic mercury ion-binding protein) (Mercury scavenger protein)
Function : -
COG functional category : -
COG ID : -
EC number : -
Position : 5552 - 5827 bp
Length : 276 bp
Strand : +
Note : Evidence 2a : Function of homologous gene experimentally demonstrated in an other organism; PubMedId : 6091128, 9188683, 9649312; Product type t : transporter

DNA sequence :
ATGCGCAAATTACTCATCGCTCTACTGGTTGCCTTGCCGTTCACGGTGCTGGCCGCGCCGTCGAAAACGGTCACACTGGC
CGTCCAGAACATGACCTGTCCGCTGTGCCCGATCACGGTCAAGAAATCGCTGGAGAAGGTAGCTGGCGTCAGCGCAGTAC
AGGTCGATTTCGACAAAAAAACAGCCACCGTCACCTACGACCCGGACAAGGCCCAGCCGGAAGCGCTGACCAAGGCCACG
ACCAACGCGGGCTACCCGTCCGCCGTGCAGAAGTGA

Protein sequence :
MRKLLIALLVALPFTVLAAPSKTVTLAVQNMTCPLCPITVKKSLEKVAGVSAVQVDFDKKTATVTYDPDKAQPEALTKAT
TNAGYPSAVQK

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
merP AAN62179.1 periplasmic mercuric ion binding protein MerP Not tested PAGI-2(C) Protein 4e-17 60
merP ACN81007.1 MerP periplasmic mercuric ion binding protein Not tested AbaR5 Protein 4e-15 55
merP CAJ77062.1 Periplasmic mercuric ion binding protein Not tested AbaR1 Protein 3e-15 55
merP AGK07081.1 MerP Not tested SGI1 Protein 8e-17 54
merP YP_006098389.1 mercuric ion transport protein Not tested Tn2411 Protein 1e-16 54
merP ABQ57373.1 MerP Not tested SGI1 Protein 8e-17 54
merP AET25399.1 MerP Not tested PAGI-2(C) Protein 8e-17 54
merP AFG30122.1 MerP Not tested PAGI-2 Protein 8e-17 54
merP AGK07023.1 MerP Not tested SGI1 Protein 8e-17 54
unnamed ABR13399.1 copper-transporting ATPase 2 Not tested PAGI-5 Protein 3e-16 54

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
merP YP_003622579.1 Mercuric transport protein periplasmic component precursor (Periplasmic mercury ion-binding protein) (Mercury scavenger protein) BAC0679 Protein 8e-16 56
merP YP_003622579.1 Mercuric transport protein periplasmic component precursor (Periplasmic mercury ion-binding protein) (Mercury scavenger protein) BAC0675 Protein 3e-16 52
merP YP_003622579.1 Mercuric transport protein periplasmic component precursor (Periplasmic mercury ion-binding protein) (Mercury scavenger protein) BAC0231 Protein 3e-17 51
merP YP_003622579.1 Mercuric transport protein periplasmic component precursor (Periplasmic mercury ion-binding protein) (Mercury scavenger protein) BAC0678 Protein 4e-16 50
merP YP_003622579.1 Mercuric transport protein periplasmic component precursor (Periplasmic mercury ion-binding protein) (Mercury scavenger protein) BAC0674 Protein 3e-13 50