
|
Name : merP1 (THI_1800) Accession : YP_003624298.1 Strain : Thiomonas sp. 3As Genome accession: NC_014145 Putative virulence/resistance : Resistance Product : Mercuric transport protein periplasmic component precursor (Periplasmic mercury ion-binding protein) (Mercury scavenger protein) Function : - COG functional category : - COG ID : - EC number : - Position : 1788315 - 1788593 bp Length : 279 bp Strand : - Note : Evidence 2a : Function of homologous gene experimentally demonstrated in an other organism; PubMedId : 6091128, 9188683, 9649312; Product type t : transporter DNA sequence : ATGAACAAGCTCCTGACTGCTATTGCCGCCGCCTGCGTTTTCAGTGCCCCTGCCTGGGCTGCAGAGCAGACCGTGACCCT CGCTGTGCCGGGCATGACCTGCGGGGTCTGCCCGATCACCGTGCACAAAGCGCTTACCGCCGTTCCCGGCGTGGAAAAAG TCAGCGTGAACGAGATGAAAAAAGACGCAGTGGTCACCTTCGACAATGCCAAGACCAACGTCAAGACCCTGATCAAAGCC ACCGCCGATGCGGGCTATCCCTCGACGGTCGTGCAATAA Protein sequence : MNKLLTAIAAACVFSAPAWAAEQTVTLAVPGMTCGVCPITVHKALTAVPGVEKVSVNEMKKDAVVTFDNAKTNVKTLIKA TADAGYPSTVVQ |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| merP | ABQ57373.1 | MerP | Not tested | SGI1 | Protein | 1e-17 | 69 |
| merP | AET25399.1 | MerP | Not tested | PAGI-2(C) | Protein | 1e-17 | 69 |
| merP | AFG30122.1 | MerP | Not tested | PAGI-2 | Protein | 1e-17 | 69 |
| merP | AGK07023.1 | MerP | Not tested | SGI1 | Protein | 1e-17 | 69 |
| merP | AGK07081.1 | MerP | Not tested | SGI1 | Protein | 1e-17 | 69 |
| merP | YP_006098389.1 | mercuric ion transport protein | Not tested | Tn2411 | Protein | 2e-17 | 69 |
| merP | CAJ77062.1 | Periplasmic mercuric ion binding protein | Not tested | AbaR1 | Protein | 3e-16 | 67 |
| merP | ACN81007.1 | MerP periplasmic mercuric ion binding protein | Not tested | AbaR5 | Protein | 5e-16 | 67 |
| merP | AAN62179.1 | periplasmic mercuric ion binding protein MerP | Not tested | PAGI-2(C) | Protein | 8e-17 | 66 |
| unnamed | ABR13399.1 | copper-transporting ATPase 2 | Not tested | PAGI-5 | Protein | 4e-19 | 63 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| merP1 | YP_003624298.1 | Mercuric transport protein periplasmic component precursor (Periplasmic mercury ion-binding protein) (Mercury scavenger protein) | BAC0678 | Protein | 5e-17 | 68 |
| merP1 | YP_003624298.1 | Mercuric transport protein periplasmic component precursor (Periplasmic mercury ion-binding protein) (Mercury scavenger protein) | BAC0679 | Protein | 7e-17 | 67 |
| merP1 | YP_003624298.1 | Mercuric transport protein periplasmic component precursor (Periplasmic mercury ion-binding protein) (Mercury scavenger protein) | BAC0675 | Protein | 1e-15 | 67 |
| merP1 | YP_003624298.1 | Mercuric transport protein periplasmic component precursor (Periplasmic mercury ion-binding protein) (Mercury scavenger protein) | BAC0231 | Protein | 6e-17 | 67 |
| merP1 | YP_003624298.1 | Mercuric transport protein periplasmic component precursor (Periplasmic mercury ion-binding protein) (Mercury scavenger protein) | BAC0674 | Protein | 2e-20 | 59 |