Gene Information

Name : MCR_0180 (MCR_0180)
Accession : YP_003626345.1
Strain : Moraxella catarrhalis RH4
Genome accession: NC_014147
Putative virulence/resistance : Virulence
Product : two-component system response regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 192895 - 193617 bp
Length : 723 bp
Strand : -
Note : -

DNA sequence :
ATGAATAAACAAATCCTACTGATTGAAGATGATCCAGATTTGGCGGAGCTGATCAGTGATTATCTATCCATGAATTATTA
TGAAGTTCATCACGCTGCAACTGGTCAAGGTGGCTTGGATATTTTGGATACCAAAGAGCGTGACATCAGTTTAATTGTTC
TAGATTTGATGTTGCCAGATATGGATGGCATGGAAGTGTGCCAAAAAGTACGCGGTTCAAAAAATACCATGATTAACAAA
GTACCGATTGTTATGCTCACCGCTAAGGGGGACACTACCGATCGTGTCTTAGGGCTTGAGATGGGTGCTGATGATTATAT
TGCCAAGCCATTTGAGCCACGAGAGCTATTGGCGCGTATCCGTGCTGTCTTGCGTCGTCACGAAACGCCAAATCAAGCAG
ATACCAACTCAGGCAGCCTAACTTTTGGTCGTTTGACGGTTTATCCAGACAGCCATGAGGTCACGATTGATGAAAAGACC
GTTCGTCTGACCACACACCAGTTTCAGCTTTTACATTATTTTGCTACGCATGCTGGCAAAGTACTCAATCGTGAGCAGCT
TTGGCAAGCCATGCCAAACGATGACAGCTCAGAAAATATTGATCGTGCCATCGATGTTCATATCTCAAGATTACGCGCTT
TGATTGAAGATAATCCACGCCAGCCCAAGCGTATCATCACAGTGCGAGGCGTTGGCTATCAGTTTGCCACCGATCAAGTT
TAA

Protein sequence :
MNKQILLIEDDPDLAELISDYLSMNYYEVHHAATGQGGLDILDTKERDISLIVLDLMLPDMDGMEVCQKVRGSKNTMINK
VPIVMLTAKGDTTDRVLGLEMGADDYIAKPFEPRELLARIRAVLRRHETPNQADTNSGSLTFGRLTVYPDSHEVTIDEKT
VRLTTHQFQLLHYFATHAGKVLNREQLWQAMPNDDSSENIDRAIDVHISRLRALIEDNPRQPKRIITVRGVGYQFATDQV

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 4e-38 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MCR_0180 YP_003626345.1 two-component system response regulator NC_012469.1.7686381. Protein 1e-44 43
MCR_0180 YP_003626345.1 two-component system response regulator NC_002952.2859905.p0 Protein 5e-41 42
MCR_0180 YP_003626345.1 two-component system response regulator NC_002745.1124361.p0 Protein 3e-41 42
MCR_0180 YP_003626345.1 two-component system response regulator NC_009782.5559369.p0 Protein 3e-41 42
MCR_0180 YP_003626345.1 two-component system response regulator NC_002951.3237708.p0 Protein 3e-41 42
MCR_0180 YP_003626345.1 two-component system response regulator NC_002758.1121668.p0 Protein 3e-41 42
MCR_0180 YP_003626345.1 two-component system response regulator NC_009641.5332272.p0 Protein 3e-41 42
MCR_0180 YP_003626345.1 two-component system response regulator NC_013450.8614421.p0 Protein 3e-41 42
MCR_0180 YP_003626345.1 two-component system response regulator NC_007622.3794472.p0 Protein 5e-41 42
MCR_0180 YP_003626345.1 two-component system response regulator NC_007793.3914279.p0 Protein 3e-41 42
MCR_0180 YP_003626345.1 two-component system response regulator NC_003923.1003749.p0 Protein 3e-41 42
MCR_0180 YP_003626345.1 two-component system response regulator HE999704.1.gene2815. Protein 7e-39 42
MCR_0180 YP_003626345.1 two-component system response regulator CP000034.1.gene3834. Protein 2e-30 41
MCR_0180 YP_003626345.1 two-component system response regulator NC_002695.1.915041.p Protein 2e-30 41
MCR_0180 YP_003626345.1 two-component system response regulator CP000034.1.gene3671. Protein 2e-43 41
MCR_0180 YP_003626345.1 two-component system response regulator CP001918.1.gene5135. Protein 6e-27 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
MCR_0180 YP_003626345.1 two-component system response regulator VFG1702 Protein 2e-38 41