Gene Information

Name : Cfla_2332 (Cfla_2332)
Accession : YP_003637421.1
Strain : Cellulomonas flavigena DSM 20109
Genome accession: NC_014151
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2606641 - 2607324 bp
Length : 684 bp
Strand : -
Note : KEGG: sgr:SGR_4523 putative two-component system response regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; transcriptional regulator domain protein

DNA sequence :
ATGAAGGGACGCGTCCTGGTGGTCGACGACGACACCGCTCTGGCCGAGATGATCGGCATCGTGCTGCGCTCGGAGGGTTT
CGACCCCGTCTTCTGCGAGGACGGCGACGAGGCGCTCGGCGTGTTCCGGGCCACGCAGCCCGACCTCGTCCTGCTCGACC
TCATGCTCCCCGGCAAGGACGGCAACGAGGTGTGCCGGCAGATCCGCGGCGAGTCCGGCGTCCCGATCGTGATGCTCACG
GCGAAGAGCGACACGATCGACGTCGTGCTCGGGCTCGAGTCGGGTGCCGACGACTACATCTCCAAGCCCTTCAAGCCCAA
GGAGCTCGTGGCACGCGTGCGGGCCCGGCTGCGCCGCAGCGACGAGCCCGCCCCGGAGCACCTGACGATCGGGGACCTCA
CGATCGACGTCCCCGGTCACCGCGTCGAGCGGGCGGGGCGCACGATCTCCCTCACGCCGCTGGAGTTCGACCTGCTCGTG
GCGCTCGCGCGCAAGCCGTGGCAGGTGTTCACCCGCGAGGTCCTGCTCGAGAAGGTGTGGGGCTACCGGCACGCCGCCGA
CACGCGGCTCGTCAACGTCCACGTGCAGCGGCTGCGCTCGAAGATCGAGACGGATCCCGCGCGTCCCGAGATCGTCGTCA
CGGTGCGCGGCGTCGGGTACAAGGCGGGCGTCGCGGGGGCGTGA

Protein sequence :
MKGRVLVVDDDTALAEMIGIVLRSEGFDPVFCEDGDEALGVFRATQPDLVLLDLMLPGKDGNEVCRQIRGESGVPIVMLT
AKSDTIDVVLGLESGADDYISKPFKPKELVARVRARLRRSDEPAPEHLTIGDLTIDVPGHRVERAGRTISLTPLEFDLLV
ALARKPWQVFTREVLLEKVWGYRHAADTRLVNVHVQRLRSKIETDPARPEIVVTVRGVGYKAGVAGA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-31 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cfla_2332 YP_003637421.1 two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 1e-74 74
Cfla_2332 YP_003637421.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 1e-40 48
Cfla_2332 YP_003637421.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 4e-41 47
Cfla_2332 YP_003637421.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 3e-41 47
Cfla_2332 YP_003637421.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 3e-41 47
Cfla_2332 YP_003637421.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 3e-41 47
Cfla_2332 YP_003637421.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 3e-41 47
Cfla_2332 YP_003637421.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 3e-41 47
Cfla_2332 YP_003637421.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 3e-41 47
Cfla_2332 YP_003637421.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 3e-41 47
Cfla_2332 YP_003637421.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 2e-41 47
Cfla_2332 YP_003637421.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 3e-41 47
Cfla_2332 YP_003637421.1 two component transcriptional regulator, winged helix family BAC0125 Protein 2e-29 44
Cfla_2332 YP_003637421.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 2e-37 44
Cfla_2332 YP_003637421.1 two component transcriptional regulator, winged helix family NC_012469.1.7686381. Protein 9e-38 43
Cfla_2332 YP_003637421.1 two component transcriptional regulator, winged helix family BAC0039 Protein 4e-35 43
Cfla_2332 YP_003637421.1 two component transcriptional regulator, winged helix family CP000647.1.gene2531. Protein 1e-33 43
Cfla_2332 YP_003637421.1 two component transcriptional regulator, winged helix family CP001138.1.gene2239. Protein 5e-35 43
Cfla_2332 YP_003637421.1 two component transcriptional regulator, winged helix family CP000034.1.gene2186. Protein 4e-35 43
Cfla_2332 YP_003637421.1 two component transcriptional regulator, winged helix family NC_002695.1.916589.p Protein 2e-35 43
Cfla_2332 YP_003637421.1 two component transcriptional regulator, winged helix family CP001918.1.gene3444. Protein 1e-34 43
Cfla_2332 YP_003637421.1 two component transcriptional regulator, winged helix family BAC0596 Protein 5e-35 43
Cfla_2332 YP_003637421.1 two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 5e-33 41
Cfla_2332 YP_003637421.1 two component transcriptional regulator, winged helix family AF155139.2.orf0.gene Protein 2e-32 41
Cfla_2332 YP_003637421.1 two component transcriptional regulator, winged helix family FJ349556.1.orf0.gene Protein 2e-31 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Cfla_2332 YP_003637421.1 two component transcriptional regulator, winged helix family VFG1389 Protein 2e-25 44
Cfla_2332 YP_003637421.1 two component transcriptional regulator, winged helix family VFG1390 Protein 2e-31 43
Cfla_2332 YP_003637421.1 two component transcriptional regulator, winged helix family VFG1702 Protein 1e-31 41