Gene Information

Name : TherJR_1220 (TherJR_1220)
Accession : YP_003639985.1
Strain : Thermincola potens JR
Genome accession: NC_014152
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1290337 - 1291029 bp
Length : 693 bp
Strand : +
Note : KEGG: cce:Ccel_1658 two component transcriptional regulator, winged helix family; PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver

DNA sequence :
ATGAGCAAAATACTCGTTGCTGATGACGACCCGAACGTCATTGAGCTGTTAAAGATATACCTGCAAAAGGAAGGATACGA
GGTATTTTTTGCTGAGAATGGCAGGGAGGCCGTTGATAAAGCCAACAGCACAAAACCTGATCTGATTGTATTGGATCTGA
TGATGCCGGAAATAGATGGGCTGGAAGTATGCCGGCAAATAAGGATGCATTCCAGAGTACCAATTATTATGCTGACGGCC
AAGGACGAAGATATGGATAAAATCCTTGGTCTGGAAATGGGAGCCGATGATTATATAACGAAGCCATTTAACCCAAGGGA
AGTGGTAGCAAGAATCAAGGCTGTTTTGCGCAGGGTAAGCGATATTTCCACAGATTCCGGAAAACAGCAGGTACTGAAAT
ATAACGGCCTGGAAATAAACATTATGGATTTTACCGTCAAACTCCAAGGCCGGGAGATTCCTTTTACCCCTAAGGAACTT
GAGTTATTATGGTTGCTGGCCAGCAATCCCGGCCGGGTGTATACAAGGGAGCAACTGTTGGAAAAAGTGTGGGGCTATGA
CTATTTTGGTGACAGCAGGACAGTAGATACTCACATAAAAAGAATCAGAAAAAAAATTGGTTCCGCTGAAGAAAGCACAT
CTTTTGATATTAAGACCGTTTGGGGCGTGGGGTATAAATTTGAGGTGAGTTAA

Protein sequence :
MSKILVADDDPNVIELLKIYLQKEGYEVFFAENGREAVDKANSTKPDLIVLDLMMPEIDGLEVCRQIRMHSRVPIIMLTA
KDEDMDKILGLEMGADDYITKPFNPREVVARIKAVLRRVSDISTDSGKQQVLKYNGLEINIMDFTVKLQGREIPFTPKEL
ELLWLLASNPGRVYTREQLLEKVWGYDYFGDSRTVDTHIKRIRKKIGSAEESTSFDIKTVWGVGYKFEVS

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-40 41
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 7e-41 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
TherJR_1220 YP_003639985.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 1e-51 51
TherJR_1220 YP_003639985.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 2e-51 50
TherJR_1220 YP_003639985.1 two component transcriptional regulator, winged helix family AF155139.2.orf0.gene Protein 6e-48 48
TherJR_1220 YP_003639985.1 two component transcriptional regulator, winged helix family DQ212986.1.gene4.p01 Protein 1e-44 47
TherJR_1220 YP_003639985.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 3e-48 47
TherJR_1220 YP_003639985.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 2e-48 47
TherJR_1220 YP_003639985.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 2e-48 47
TherJR_1220 YP_003639985.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 2e-48 47
TherJR_1220 YP_003639985.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 3e-48 47
TherJR_1220 YP_003639985.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 2e-48 47
TherJR_1220 YP_003639985.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 2e-48 47
TherJR_1220 YP_003639985.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 2e-48 47
TherJR_1220 YP_003639985.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 2e-48 47
TherJR_1220 YP_003639985.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 3e-48 47
TherJR_1220 YP_003639985.1 two component transcriptional regulator, winged helix family AF130997.1.orf0.gene Protein 3e-41 46
TherJR_1220 YP_003639985.1 two component transcriptional regulator, winged helix family AM180355.1.gene1830. Protein 7e-45 46
TherJR_1220 YP_003639985.1 two component transcriptional regulator, winged helix family FJ349556.1.orf0.gene Protein 4e-47 46
TherJR_1220 YP_003639985.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 1e-35 44
TherJR_1220 YP_003639985.1 two component transcriptional regulator, winged helix family CP000034.1.gene2186. Protein 1e-41 44
TherJR_1220 YP_003639985.1 two component transcriptional regulator, winged helix family NC_002695.1.916589.p Protein 7e-42 44
TherJR_1220 YP_003639985.1 two component transcriptional regulator, winged helix family CP001138.1.gene2239. Protein 2e-41 44
TherJR_1220 YP_003639985.1 two component transcriptional regulator, winged helix family BAC0039 Protein 1e-41 44
TherJR_1220 YP_003639985.1 two component transcriptional regulator, winged helix family BAC0596 Protein 2e-41 44
TherJR_1220 YP_003639985.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 8e-38 43
TherJR_1220 YP_003639985.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 8e-38 43
TherJR_1220 YP_003639985.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 8e-38 43
TherJR_1220 YP_003639985.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 8e-38 43
TherJR_1220 YP_003639985.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 8e-38 43
TherJR_1220 YP_003639985.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 8e-38 43
TherJR_1220 YP_003639985.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 8e-38 43
TherJR_1220 YP_003639985.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 8e-38 43
TherJR_1220 YP_003639985.1 two component transcriptional regulator, winged helix family AE016830.1.gene1681. Protein 1e-44 43
TherJR_1220 YP_003639985.1 two component transcriptional regulator, winged helix family AF162694.1.orf4.gene Protein 4e-37 43
TherJR_1220 YP_003639985.1 two component transcriptional regulator, winged helix family AE000516.2.gene3505. Protein 2e-42 43
TherJR_1220 YP_003639985.1 two component transcriptional regulator, winged helix family CP001918.1.gene3444. Protein 2e-41 43
TherJR_1220 YP_003639985.1 two component transcriptional regulator, winged helix family CP000647.1.gene2531. Protein 3e-41 43
TherJR_1220 YP_003639985.1 two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 2e-32 42
TherJR_1220 YP_003639985.1 two component transcriptional regulator, winged helix family NC_014475.1.orf0.gen Protein 7e-44 42
TherJR_1220 YP_003639985.1 two component transcriptional regulator, winged helix family NC_005054.2598277.p0 Protein 7e-44 42
TherJR_1220 YP_003639985.1 two component transcriptional regulator, winged helix family EU250284.1.orf4.gene Protein 1e-38 42
TherJR_1220 YP_003639985.1 two component transcriptional regulator, winged helix family NC_012469.1.7686381. Protein 6e-43 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
TherJR_1220 YP_003639985.1 two component transcriptional regulator, winged helix family VFG1702 Protein 1e-40 41
TherJR_1220 YP_003639985.1 two component transcriptional regulator, winged helix family VFG1390 Protein 1e-36 41
TherJR_1220 YP_003639985.1 two component transcriptional regulator, winged helix family VFG1563 Protein 4e-41 41