Gene Information

Name : TherJR_2684 (TherJR_2684)
Accession : YP_003641420.1
Strain : Thermincola potens JR
Genome accession: NC_014152
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator, winged helix family
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 2790721 - 2791407 bp
Length : 687 bp
Strand : -
Note : KEGG: dae:Dtox_3055 two component transcriptional regulator, winged helix family; PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver

DNA sequence :
ATGGCCGGTGAAAAAATATTAATAATTGAGGACGAAGTAAAGATAGCCCGCTTTCTGGAATTGGAACTGAAATACGAGGG
GTATATGGTTGAACAGGAGAATGACGGCAGAAGCGGCCTGGAAAGAGCTACTGGGGGTAAATTTGATTTAATAATTCTGG
ATGTAATGCTTCCCTCTCTCAATGGTATGGAGGTGTTGAGACGTTTACGGCAGGTTTCCGAAACGCCGGTCATAATGCTC
ACTGCTAAGGACGAGGTAACGGATAAGGTCATGGGGCTTGACATCGGCGCCGATGACTATATGACCAAACCTTTTGCTAT
TGAAGAGTTGCTGGCCCGGATCAGGGCGGTCCTTAAAAGAAGGAAACCGGCCAATCACAAAAGAGATATAATTACCGCGG
GAGACTTAAAAATAAACCTGGAACAGCATTCAGTGTGTTTTAATAAAGAACCGGTGGACCTTACGAAAAAAGAATACGAC
CTGTTATGTTATCTGGTTCAAAATAAAAATATGGTCCTCACAAGGGATAAAATTCTGGAAACGGTATGGGGTTACGATTA
TTACGGTGATACCAATGTGGTGGATGTGTATATAAGGTACTTACGAAGCAAAATAGATGACAGGTTTAATACTAAGCTTA
TCCATACTGTAAGGGGAGTAGGTTATATAATTAAAGATGAACAATAG

Protein sequence :
MAGEKILIIEDEVKIARFLELELKYEGYMVEQENDGRSGLERATGGKFDLIILDVMLPSLNGMEVLRRLRQVSETPVIML
TAKDEVTDKVMGLDIGADDYMTKPFAIEELLARIRAVLKRRKPANHKRDIITAGDLKINLEQHSVCFNKEPVDLTKKEYD
LLCYLVQNKNMVLTRDKILETVWGYDYYGDTNVVDVYIRYLRSKIDDRFNTKLIHTVRGVGYIIKDEQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-42 46
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-41 44
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 5e-32 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
TherJR_2684 YP_003641420.1 two component transcriptional regulator, winged helix family NC_007793.3914065.p0 Protein 5e-52 55
TherJR_2684 YP_003641420.1 two component transcriptional regulator, winged helix family NC_002758.1121390.p0 Protein 5e-52 55
TherJR_2684 YP_003641420.1 two component transcriptional regulator, winged helix family NC_010079.5776364.p0 Protein 5e-52 55
TherJR_2684 YP_003641420.1 two component transcriptional regulator, winged helix family NC_002952.2859858.p0 Protein 5e-52 55
TherJR_2684 YP_003641420.1 two component transcriptional regulator, winged helix family NC_007622.3794948.p0 Protein 5e-52 55
TherJR_2684 YP_003641420.1 two component transcriptional regulator, winged helix family NC_003923.1003417.p0 Protein 5e-52 55
TherJR_2684 YP_003641420.1 two component transcriptional regulator, winged helix family NC_013450.8614146.p0 Protein 5e-52 55
TherJR_2684 YP_003641420.1 two component transcriptional regulator, winged helix family NC_002951.3238224.p0 Protein 5e-52 55
TherJR_2684 YP_003641420.1 two component transcriptional regulator, winged helix family HE999704.1.gene1528. Protein 4e-45 54
TherJR_2684 YP_003641420.1 two component transcriptional regulator, winged helix family AE015929.1.gene1106. Protein 3e-47 53
TherJR_2684 YP_003641420.1 two component transcriptional regulator, winged helix family BAC0308 Protein 3e-45 48
TherJR_2684 YP_003641420.1 two component transcriptional regulator, winged helix family BAC0125 Protein 6e-45 46
TherJR_2684 YP_003641420.1 two component transcriptional regulator, winged helix family BAC0197 Protein 4e-45 45
TherJR_2684 YP_003641420.1 two component transcriptional regulator, winged helix family HE999704.1.gene2815. Protein 2e-43 45
TherJR_2684 YP_003641420.1 two component transcriptional regulator, winged helix family NC_012469.1.7685629. Protein 4e-41 44
TherJR_2684 YP_003641420.1 two component transcriptional regulator, winged helix family NC_012469.1.7686381. Protein 3e-41 44
TherJR_2684 YP_003641420.1 two component transcriptional regulator, winged helix family BAC0083 Protein 5e-44 43
TherJR_2684 YP_003641420.1 two component transcriptional regulator, winged helix family BAC0638 Protein 5e-39 43
TherJR_2684 YP_003641420.1 two component transcriptional regulator, winged helix family NC_002952.2859905.p0 Protein 5e-40 43
TherJR_2684 YP_003641420.1 two component transcriptional regulator, winged helix family NC_002745.1124361.p0 Protein 4e-40 43
TherJR_2684 YP_003641420.1 two component transcriptional regulator, winged helix family NC_009782.5559369.p0 Protein 4e-40 43
TherJR_2684 YP_003641420.1 two component transcriptional regulator, winged helix family NC_002951.3237708.p0 Protein 4e-40 43
TherJR_2684 YP_003641420.1 two component transcriptional regulator, winged helix family NC_002758.1121668.p0 Protein 4e-40 43
TherJR_2684 YP_003641420.1 two component transcriptional regulator, winged helix family NC_009641.5332272.p0 Protein 4e-40 43
TherJR_2684 YP_003641420.1 two component transcriptional regulator, winged helix family NC_013450.8614421.p0 Protein 4e-40 43
TherJR_2684 YP_003641420.1 two component transcriptional regulator, winged helix family NC_007622.3794472.p0 Protein 5e-40 43
TherJR_2684 YP_003641420.1 two component transcriptional regulator, winged helix family NC_007793.3914279.p0 Protein 4e-40 43
TherJR_2684 YP_003641420.1 two component transcriptional regulator, winged helix family NC_003923.1003749.p0 Protein 4e-40 43
TherJR_2684 YP_003641420.1 two component transcriptional regulator, winged helix family FJ349556.1.orf0.gene Protein 1e-36 42
TherJR_2684 YP_003641420.1 two component transcriptional regulator, winged helix family AF155139.2.orf0.gene Protein 3e-37 42
TherJR_2684 YP_003641420.1 two component transcriptional regulator, winged helix family AM180355.1.gene1830. Protein 2e-30 41
TherJR_2684 YP_003641420.1 two component transcriptional regulator, winged helix family BAC0111 Protein 8e-41 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
TherJR_2684 YP_003641420.1 two component transcriptional regulator, winged helix family VFG0596 Protein 5e-43 46
TherJR_2684 YP_003641420.1 two component transcriptional regulator, winged helix family VFG1389 Protein 3e-44 45
TherJR_2684 YP_003641420.1 two component transcriptional regulator, winged helix family VFG1390 Protein 8e-46 42
TherJR_2684 YP_003641420.1 two component transcriptional regulator, winged helix family VFG1386 Protein 5e-47 42
TherJR_2684 YP_003641420.1 two component transcriptional regulator, winged helix family VFG1702 Protein 2e-32 41