Gene Information

Name : Tint_0122 (Tint_0122)
Accession : YP_003641865.1
Strain : Thiomonas intermedia K12
Genome accession: NC_014153
Putative virulence/resistance : Virulence
Product : microcompartments protein
Function : -
COG functional category : Q : Secondary metabolites biosynthesis, transport and catabolism
COG ID : COG4577
EC number : -
Position : 136400 - 136696 bp
Length : 297 bp
Strand : +
Note : KEGG: net:Neut_0811 microcompartments protein; PFAM: microcompartments protein; SMART: microcompartments protein

DNA sequence : 
ATGGCGAACGTGAATGGAATTGCCCTGGGCATGATCGAAACGCGCGGACTGGTGCCGGCGATCGAAGCGGCTGATGCCAT
GTGCAAAGCAGCGGAAGTGCGACTGATCGGTCGCCAGTTCGTGGGCGGCGGCTACGTCACCGTACTGGTGCGCGGCGAAA
CAGGCGCGGTCAACGCGGCGGTGCGCGCGGGTGCCGATGCCTGCGAGCGCGTGGGTGACGGCCTGGTGGCTGCGCACATC
ATTGCCCGCGTGCACAGCGAAGTCGAAGGTATTCTGCCTTCCACGCCGAGCGCCTGA

Protein sequence : 
MANVNGIALGMIETRGLVPAIEAADAMCKAAEVRLIGRQFVGGGYVTVLVRGETGAVNAAVRAGADACERVGDGLVAAHI
IARVHSEVEGILPSTPSA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42077.1 hypothetical protein Not tested PAI II 536 Protein 5e-12 59
unnamed CAD42078.1 hypothetical protein Not tested PAI II 536 Protein 5e-12 54
unnamed CAD42079.1 hypothetical protein Not tested PAI II 536 Protein 3e-11 50

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tint_0122 YP_003641865.1 microcompartments protein VFG1596 Protein 2e-12 59
Tint_0122 YP_003641865.1 microcompartments protein VFG1597 Protein 2e-12 54
Tint_0122 YP_003641865.1 microcompartments protein VFG1598 Protein 1e-11 50