
|
Name : Tint_1277 (Tint_1277) Accession : YP_003642995.1 Strain : Thiomonas intermedia K12 Genome accession: NC_014153 Putative virulence/resistance : Virulence Product : winged helix family two component transcriptional regulator Function : - COG functional category : T : Signal transduction mechanisms COG ID : COG0745 EC number : - Position : 1367313 - 1368041 bp Length : 729 bp Strand : + Note : TIGRFAM: heavy metal response regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; KEGG: bpy:Bphyt_5224 two component heavy metal response transcriptional regulator, winged helix family; SMART: response regulator receive DNA sequence : ATGTTGCAGACCGATACGTCGCTCTGCCAGCGGCGGGCCGACAATGCGGGGATGCGAATTCTCATTGTCGAAGATGAGGC CAAAACGGCGGCCTATCTCAAGCGCGGACTCGGGGAGAACGGCTTCATCGCAGATGTCGCCGTCGATGGCACGGATGGTC TGCATCTGGCGCTGACCCAGCCGTACGACTTGATCGTGCTCGATGCCATGCTGCCCGGCCGCGACGGCTGGAGCGTGCTG AGCGAACTGCGGGCGCGGCAGACCACCCCGGTGCTCATGCTCACCGCGCGCGACGGCGTGGCCGATCGGGTGCGCGGACT GGAGCTGGGCGCTGACGACTATCTGGTCAAGCCTTTCGCGTTTTCTGAGCTGCTGGCGCGGGTGCGCAGCGTGCTGCGGC GCGGTGTCACGCGCATGCCCGACGTGATGGAAGTGGCCGATCTGCGGGTTGACATGCATCGCCAGCGCGCCGAGCGCAGC GGGCAGCGGCTGGCGCTCACCCCCAAGGAGTTCGCGCTGCTGGCGCTGTTGTCACGACGCGCTGGCGAGGTGCTGTCGCG CACCCTGATTGCCGAACAGGTCTGGGATATGAACTTCGACAGCGACACCAATGTGGTGGACGTACACATTCGTCGCTTAC GCAGCAAGCTCGACGAGCCCTTCCCCGCGCCGCTGTTGCACACCGTCCGCGGGGTGGGTTATGTATTGGAAGTGCGCGAT GCAAAGTGA Protein sequence : MLQTDTSLCQRRADNAGMRILIVEDEAKTAAYLKRGLGENGFIADVAVDGTDGLHLALTQPYDLIVLDAMLPGRDGWSVL SELRARQTTPVLMLTARDGVADRVRGLELGADDYLVKPFAFSELLARVRSVLRRGVTRMPDVMEVADLRVDMHRQRAERS GQRLALTPKEFALLALLSRRAGEVLSRTLIAEQVWDMNFDSDTNVVDVHIRRLRSKLDEPFPAPLLHTVRGVGYVLEVRD AK |
| Gene | GenBank Accn | Product | Virulance or Resistance | PAI or REI | Alignment Type | E-val | Identity |
| copR | NP_460069.2 | transcriptional regulatory protein YedW | Not tested | SPI-5 | Protein | 3e-58 | 56 |
| copR | AAC33719.1 | regulatory protein CopR | Not tested | SPI-5 | Protein | 1e-57 | 54 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| Tint_1277 | YP_003642995.1 | winged helix family two component transcriptional regulator | BAC0197 | Protein | 8e-70 | 66 |
| Tint_1277 | YP_003642995.1 | winged helix family two component transcriptional regulator | BAC0083 | Protein | 5e-66 | 62 |
| Tint_1277 | YP_003642995.1 | winged helix family two component transcriptional regulator | BAC0125 | Protein | 9e-66 | 61 |
| Tint_1277 | YP_003642995.1 | winged helix family two component transcriptional regulator | BAC0308 | Protein | 1e-61 | 59 |
| Tint_1277 | YP_003642995.1 | winged helix family two component transcriptional regulator | BAC0638 | Protein | 2e-57 | 59 |
| Tint_1277 | YP_003642995.1 | winged helix family two component transcriptional regulator | BAC0111 | Protein | 4e-64 | 58 |
| Tint_1277 | YP_003642995.1 | winged helix family two component transcriptional regulator | BAC0347 | Protein | 7e-58 | 54 |
| Tint_1277 | YP_003642995.1 | winged helix family two component transcriptional regulator | AE015929.1.gene1106. | Protein | 1e-37 | 44 |
| Tint_1277 | YP_003642995.1 | winged helix family two component transcriptional regulator | NC_010079.5776364.p0 | Protein | 3e-41 | 43 |
| Tint_1277 | YP_003642995.1 | winged helix family two component transcriptional regulator | NC_002952.2859858.p0 | Protein | 3e-41 | 43 |
| Tint_1277 | YP_003642995.1 | winged helix family two component transcriptional regulator | NC_007622.3794948.p0 | Protein | 3e-41 | 43 |
| Tint_1277 | YP_003642995.1 | winged helix family two component transcriptional regulator | NC_003923.1003417.p0 | Protein | 3e-41 | 43 |
| Tint_1277 | YP_003642995.1 | winged helix family two component transcriptional regulator | NC_013450.8614146.p0 | Protein | 3e-41 | 43 |
| Tint_1277 | YP_003642995.1 | winged helix family two component transcriptional regulator | NC_002951.3238224.p0 | Protein | 3e-41 | 43 |
| Tint_1277 | YP_003642995.1 | winged helix family two component transcriptional regulator | NC_007793.3914065.p0 | Protein | 3e-41 | 43 |
| Tint_1277 | YP_003642995.1 | winged helix family two component transcriptional regulator | NC_002758.1121390.p0 | Protein | 3e-41 | 43 |
| Tint_1277 | YP_003642995.1 | winged helix family two component transcriptional regulator | U82965.2.orf14.gene. | Protein | 7e-29 | 43 |
| Tint_1277 | YP_003642995.1 | winged helix family two component transcriptional regulator | CP001918.1.gene5135. | Protein | 8e-25 | 43 |
| Tint_1277 | YP_003642995.1 | winged helix family two component transcriptional regulator | CP000647.1.gene4257. | Protein | 8e-27 | 42 |
| Tint_1277 | YP_003642995.1 | winged helix family two component transcriptional regulator | BAC0533 | Protein | 8e-27 | 42 |
| Tint_1277 | YP_003642995.1 | winged helix family two component transcriptional regulator | Y16952.3.orf35.gene. | Protein | 4e-25 | 42 |
| Tint_1277 | YP_003642995.1 | winged helix family two component transcriptional regulator | AE000516.2.gene3505. | Protein | 1e-32 | 42 |
| Tint_1277 | YP_003642995.1 | winged helix family two component transcriptional regulator | HE999704.1.gene1528. | Protein | 5e-31 | 41 |
| Tint_1277 | YP_003642995.1 | winged helix family two component transcriptional regulator | NC_002952.2859905.p0 | Protein | 2e-36 | 41 |
| Tint_1277 | YP_003642995.1 | winged helix family two component transcriptional regulator | CP004022.1.gene3215. | Protein | 3e-31 | 41 |
| Tint_1277 | YP_003642995.1 | winged helix family two component transcriptional regulator | NC_002695.1.915041.p | Protein | 4e-26 | 41 |
| Tint_1277 | YP_003642995.1 | winged helix family two component transcriptional regulator | CP001485.1.gene721.p | Protein | 5e-31 | 41 |
| Tint_1277 | YP_003642995.1 | winged helix family two component transcriptional regulator | CP000034.1.gene3834. | Protein | 4e-26 | 41 |
| Tint_1277 | YP_003642995.1 | winged helix family two component transcriptional regulator | CP001138.1.gene4273. | Protein | 3e-26 | 41 |
| Tint_1277 | YP_003642995.1 | winged helix family two component transcriptional regulator | NC_003923.1003749.p0 | Protein | 2e-36 | 41 |
| Tint_1277 | YP_003642995.1 | winged helix family two component transcriptional regulator | NC_009782.5559369.p0 | Protein | 2e-36 | 41 |
| Tint_1277 | YP_003642995.1 | winged helix family two component transcriptional regulator | NC_012469.1.7686381. | Protein | 8e-34 | 41 |
| Tint_1277 | YP_003642995.1 | winged helix family two component transcriptional regulator | NC_002951.3237708.p0 | Protein | 2e-36 | 41 |
| Tint_1277 | YP_003642995.1 | winged helix family two component transcriptional regulator | NC_002745.1124361.p0 | Protein | 2e-36 | 41 |
| Tint_1277 | YP_003642995.1 | winged helix family two component transcriptional regulator | NC_009641.5332272.p0 | Protein | 2e-36 | 41 |
| Tint_1277 | YP_003642995.1 | winged helix family two component transcriptional regulator | NC_013450.8614421.p0 | Protein | 2e-36 | 41 |
| Tint_1277 | YP_003642995.1 | winged helix family two component transcriptional regulator | NC_007622.3794472.p0 | Protein | 3e-36 | 41 |
| Tint_1277 | YP_003642995.1 | winged helix family two component transcriptional regulator | NC_007793.3914279.p0 | Protein | 2e-36 | 41 |
| Tint_1277 | YP_003642995.1 | winged helix family two component transcriptional regulator | NC_002758.1121668.p0 | Protein | 2e-36 | 41 |
| Gene | GenBank Accn | Product | ID of source DB | Alignment Type | E-val | Identity |
| Tint_1277 | YP_003642995.1 | winged helix family two component transcriptional regulator | VFG0596 | Protein | 1e-58 | 56 |
| Tint_1277 | YP_003642995.1 | winged helix family two component transcriptional regulator | VFG1389 | Protein | 3e-36 | 50 |
| Tint_1277 | YP_003642995.1 | winged helix family two component transcriptional regulator | VFG1390 | Protein | 1e-36 | 43 |
| Tint_1277 | YP_003642995.1 | winged helix family two component transcriptional regulator | VFG0473 | Protein | 1e-31 | 41 |
| Tint_1277 | YP_003642995.1 | winged helix family two component transcriptional regulator | VFG1386 | Protein | 6e-34 | 41 |