Gene Information

Name : Tbis_3089 (Tbis_3089)
Accession : YP_003653677.1
Strain : Thermobispora bispora DSM 43833
Genome accession: NC_014165
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3623081 - 3623755 bp
Length : 675 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: sat:SYN_00981 response regulator

DNA sequence :
GTGGCAGGCATCCTTCTCGTCGAAGACGACCCTTCGGTCCGGACCGGGCTGGAGCTCGCGCTCACCCGGCAGGGTCACTC
GGTGACGTCGTGCGCGACGGGTGAAGAGGCGCTCGACCACGTGCGCACCCGCCGTCCCGAGATCGTGATCCTGGACGTCA
TGCTCCCGGGCATCGACGGGATCGAGGTCTGCCGTCGCATCCGCAAGATCGACTCGCTTCCGGTCATCCTGCTCACCGCG
CTCGGCGACGACCTCGACGTGGTGGTCGGGCTTGAGGCGGGCGCCGACGACTACGTGGTGAAGCCCGTGCAGCCGCGGGT
GCTCGACGCCCGGATCCGCGCCATCCTCCGGCGCGTGGAGTCGGTCCCGGCCGACCGGCTCACCTTCGGCGACCTCGTGA
TCGACCGGGGGGCGCTCAAGGTGACCCTGAAGGGCAAGGAGGTCCACCTCACCCCGACCGAGCTGCGGCTGCTCCTGGAG
CTCGTCCGCCACCGGGACAAGGTGCTCAACCGCCGCTACCTCCTCCGCACCGTCTGGGATCACGGCCACGTGGGCGACTC
CCGGCTCGTCGACACCTGCGTCCAGCGGATCCGGGCGAAGATCGAGCCGGTGCCCTCCGAGCCGAGGTACATCCACACCG
TCCGCGGCTTCGGCTACCGGTTCAGCCCTCCATGA

Protein sequence :
MAGILLVEDDPSVRTGLELALTRQGHSVTSCATGEEALDHVRTRRPEIVILDVMLPGIDGIEVCRRIRKIDSLPVILLTA
LGDDLDVVVGLEAGADDYVVKPVQPRVLDARIRAILRRVESVPADRLTFGDLVIDRGALKVTLKGKEVHLTPTELRLLLE
LVRHRDKVLNRRYLLRTVWDHGHVGDSRLVDTCVQRIRAKIEPVPSEPRYIHTVRGFGYRFSPP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-24 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 2e-24 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tbis_3089 YP_003653677.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 6e-34 47
Tbis_3089 YP_003653677.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 7e-35 43
Tbis_3089 YP_003653677.1 winged helix family two component transcriptional regulator BAC0197 Protein 3e-22 43
Tbis_3089 YP_003653677.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 1e-31 42
Tbis_3089 YP_003653677.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-31 42
Tbis_3089 YP_003653677.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-31 42
Tbis_3089 YP_003653677.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 1e-31 42
Tbis_3089 YP_003653677.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-31 42
Tbis_3089 YP_003653677.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-31 42
Tbis_3089 YP_003653677.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-31 42
Tbis_3089 YP_003653677.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-31 42
Tbis_3089 YP_003653677.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-31 42
Tbis_3089 YP_003653677.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-31 42
Tbis_3089 YP_003653677.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 2e-31 41
Tbis_3089 YP_003653677.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 2e-31 41
Tbis_3089 YP_003653677.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 2e-31 41
Tbis_3089 YP_003653677.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 2e-31 41
Tbis_3089 YP_003653677.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 2e-31 41
Tbis_3089 YP_003653677.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 2e-31 41
Tbis_3089 YP_003653677.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 2e-31 41
Tbis_3089 YP_003653677.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 2e-31 41
Tbis_3089 YP_003653677.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 4e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tbis_3089 YP_003653677.1 winged helix family two component transcriptional regulator VFG1563 Protein 7e-25 42
Tbis_3089 YP_003653677.1 winged helix family two component transcriptional regulator VFG1702 Protein 7e-25 42
Tbis_3089 YP_003653677.1 winged helix family two component transcriptional regulator VFG1390 Protein 5e-25 41