Gene Information

Name : Tbis_0499 (Tbis_0499)
Accession : YP_003651120.1
Strain : Thermobispora bispora DSM 43833
Genome accession: NC_014165
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 548385 - 549074 bp
Length : 690 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: bcb:BCB4264_A5589 DNA-binding response regulator YycF

DNA sequence :
GTGACCCGCGTGCTCGTCGTCGAGGACGAAGAGTCGTTCTCCGACGCCTTGTCGTACATGCTGCGCAAAGAGGGGTTCGA
GGTCGCGGTCGCGGCCAGCGGACCCGAGGCGCTGGAGGTCTTCGACCGCGAGGGCGCCGACCTCGTCCTGCTCGATCTCA
TGCTCCCGGGCCTGCCGGGGACCGAGGTGTGCCGCTCGCTCCGGCAGAGGTCGAAGGTACCGGTGATCATGCTCACCGCG
AAGGACAGCGAGATCGACAAGATCGTGGGCCTGGAGCTCGGCGCGGACGACTATGTGACGAAGCCGTTCTCCTCCCGGGA
GCTGGTGGCGCGGATCCGCGCCGTGCTCCGCCGCCGGGGCGACGCCGAGGAGCCCTCGTCCTCGGTGCTCGCGGCCGGTC
CGGTCCGGATGGACGTCGACCGGCACGTGGTGACCGTGCGCGGGGAGAAGGTCCAGCTCCCGCTGAAGGAGTTCGAGCTG
CTCGAGGTGCTGCTCCGCAACGCCGGGCGGGTGCTCACCCGCGGCCAGCTCATCGACCGGGTCTGGGGCGCCGACTACGT
GGGCGACACCAAGACGCTCGACGTGCACATCAAGCGGCTGCGGGCCAAGATCGAGCCCGATCCGTCCAAGCCCCGGTACA
TCCTCACCGTCCGCGGCCTGGGCTACAAGTTCGAGACCGCGGAGAACTGA

Protein sequence :
MTRVLVVEDEESFSDALSYMLRKEGFEVAVAASGPEALEVFDREGADLVLLDLMLPGLPGTEVCRSLRQRSKVPVIMLTA
KDSEIDKIVGLELGADDYVTKPFSSRELVARIRAVLRRRGDAEEPSSSVLAAGPVRMDVDRHVVTVRGEKVQLPLKEFEL
LEVLLRNAGRVLTRGQLIDRVWGADYVGDTKTLDVHIKRLRAKIEPDPSKPRYILTVRGLGYKFETAEN

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB YP_001698483.1 regulatory protein Not tested Not named Protein 2e-22 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tbis_0499 YP_003651120.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 1e-35 49
Tbis_0499 YP_003651120.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 6e-36 48
Tbis_0499 YP_003651120.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 6e-36 48
Tbis_0499 YP_003651120.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 4e-35 48
Tbis_0499 YP_003651120.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 2e-39 48
Tbis_0499 YP_003651120.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 7e-36 46
Tbis_0499 YP_003651120.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 7e-36 46
Tbis_0499 YP_003651120.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 7e-36 46
Tbis_0499 YP_003651120.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 7e-36 46
Tbis_0499 YP_003651120.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 7e-36 46
Tbis_0499 YP_003651120.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 7e-36 46
Tbis_0499 YP_003651120.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 7e-36 46
Tbis_0499 YP_003651120.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 7e-36 46
Tbis_0499 YP_003651120.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 4e-34 46
Tbis_0499 YP_003651120.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 8e-28 44
Tbis_0499 YP_003651120.1 winged helix family two component transcriptional regulator BAC0308 Protein 7e-23 42
Tbis_0499 YP_003651120.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 6e-21 42
Tbis_0499 YP_003651120.1 winged helix family two component transcriptional regulator BAC0125 Protein 1e-22 42
Tbis_0499 YP_003651120.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 8e-38 42
Tbis_0499 YP_003651120.1 winged helix family two component transcriptional regulator CP000034.1.gene3671. Protein 1e-26 42
Tbis_0499 YP_003651120.1 winged helix family two component transcriptional regulator BAC0083 Protein 4e-23 41
Tbis_0499 YP_003651120.1 winged helix family two component transcriptional regulator CP001918.1.gene5135. Protein 1e-17 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tbis_0499 YP_003651120.1 winged helix family two component transcriptional regulator VFG1389 Protein 9e-23 45
Tbis_0499 YP_003651120.1 winged helix family two component transcriptional regulator VFG1386 Protein 2e-21 44
Tbis_0499 YP_003651120.1 winged helix family two component transcriptional regulator VFG1390 Protein 4e-25 42