Gene Information

Name : Tbis_0770 (Tbis_0770)
Accession : YP_003651387.1
Strain : Thermobispora bispora DSM 43833
Genome accession: NC_014165
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 861824 - 862501 bp
Length : 678 bp
Strand : +
Note : PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver; KEGG: bsu:BSU40410 hypothetical protein

DNA sequence :
ATGAAAGGACGCGTGCTGGTCGTCGATGACGACGCCGCTCTCGCCGAGATGCTCGGCATCGTCTTGCGCGGCGAGGGCTT
CGAGCCGTCGTTCGTGTACGACGGTGACAAGGCGCTTGATGCGTTCCGTGAGATCCGACCGGACCTCGTCCTCCTTGATC
TTATGCTCCCCGGAGCAGACGGCATCGACGTATGCCGCCGCATCCGCGCTGAGTCCGGCGTGCCGATCGTCATGCTGACC
GCGAAGAGCGACACGGTCGACGTGGTCCTCGGCCTGGAGTCCGGCGCCGACGACTACATCATCAAGCCGTTCAAGCCCAA
GGAGCTCATCGCGCGCATCCGGGCGAGGCTCCGCCGTACCGAGGAGCCGACCCCCGAGATCCTCCAGATCGGCGACATCA
CGATCGACGTGGCCGGCCACTCGGTGAAGCGGGGCGACCAGACGATCAACCTCACGCCGCTGGAGTTCGACCTGCTGGTC
GCGCTGGCGCGCAAGCCGCGCCAGGTGTTCACCCGAGAGGTGCTGCTCGAGCAGGTCTGGGGTTACCGGCACGCCGCCGA
CACCCGGCTGGTCAACGTCCACGTCCAGCGGCTCCGCGCGAAGATCGAGAAGGACCCGGAGCACCCCGAGATCGTGGTGA
CGGTCCGGGGTGTCGGCTACAAGGCCGGCCCGGCGTAA

Protein sequence :
MKGRVLVVDDDAALAEMLGIVLRGEGFEPSFVYDGDKALDAFREIRPDLVLLDLMLPGADGIDVCRRIRAESGVPIVMLT
AKSDTVDVVLGLESGADDYIIKPFKPKELIARIRARLRRTEEPTPEILQIGDITIDVAGHSVKRGDQTINLTPLEFDLLV
ALARKPRQVFTREVLLEQVWGYRHAADTRLVNVHVQRLRAKIEKDPEHPEIVVTVRGVGYKAGPA

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 8e-33 42
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-32 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tbis_0770 YP_003651387.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 3e-80 77
Tbis_0770 YP_003651387.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 9e-42 46
Tbis_0770 YP_003651387.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 1e-41 46
Tbis_0770 YP_003651387.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 1e-41 46
Tbis_0770 YP_003651387.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 1e-41 46
Tbis_0770 YP_003651387.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 1e-41 46
Tbis_0770 YP_003651387.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 1e-41 46
Tbis_0770 YP_003651387.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 1e-41 46
Tbis_0770 YP_003651387.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 1e-41 46
Tbis_0770 YP_003651387.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 9e-42 46
Tbis_0770 YP_003651387.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 1e-41 46
Tbis_0770 YP_003651387.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 2e-38 45
Tbis_0770 YP_003651387.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 1e-40 45
Tbis_0770 YP_003651387.1 winged helix family two component transcriptional regulator BAC0125 Protein 6e-30 44
Tbis_0770 YP_003651387.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 7e-37 44
Tbis_0770 YP_003651387.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 2e-36 43
Tbis_0770 YP_003651387.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 3e-36 42
Tbis_0770 YP_003651387.1 winged helix family two component transcriptional regulator BAC0596 Protein 3e-35 42
Tbis_0770 YP_003651387.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 6e-35 42
Tbis_0770 YP_003651387.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 3e-35 42
Tbis_0770 YP_003651387.1 winged helix family two component transcriptional regulator BAC0039 Protein 6e-35 42
Tbis_0770 YP_003651387.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 3e-35 42
Tbis_0770 YP_003651387.1 winged helix family two component transcriptional regulator CP001918.1.gene3444. Protein 6e-35 42
Tbis_0770 YP_003651387.1 winged helix family two component transcriptional regulator CP000647.1.gene2531. Protein 1e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Tbis_0770 YP_003651387.1 winged helix family two component transcriptional regulator VFG1390 Protein 9e-32 44
Tbis_0770 YP_003651387.1 winged helix family two component transcriptional regulator VFG1702 Protein 3e-33 42
Tbis_0770 YP_003651387.1 winged helix family two component transcriptional regulator VFG1389 Protein 5e-26 42
Tbis_0770 YP_003651387.1 winged helix family two component transcriptional regulator VFG1563 Protein 6e-33 41