Gene Information

Name : Arnit_3130 (Arnit_3130)
Accession : YP_003657282.1
Strain : Arcobacter nitrofigilis DSM 7299
Genome accession: NC_014166
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3175915 - 3176583 bp
Length : 669 bp
Strand : +
Note : COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789:IPR011006:IPR011991:IPR001867; KEGG: abu:Abu_0434 two-component response regulator; PFAM: response regulator receiver; tr

DNA sequence :
ATGAAAATTTTAATAATCGAAGATGATGTAAAAATCGTAAATTTTTTAAAAAAAGGCTTAGAAGAAGAGTCTTATAGTAT
AGATTATTCACACAATGGGGAAGAGGGATTATATTTAGCAAGTGTCAATAGCTATGATTTGATTTTACTTGATATTATGC
TTCCTTTACTTGATGGAATAGAAGTGTGCAAAAAATTGAGAGCTGAAAAGATAAATACTCCAATTATAATGCTAACAGCA
AAGGATAGTATTGAAGATACTATAAAAGGCTTAGATATTGGGGCAAATGATTATTTACCTAAACCTTTCTCTTTTTCTGA
ACTATTAGCAAGAATAAGAGTGCAATTAAGAGCAAAAGATTCAACTCAAACCACTCTTAAAATAGCAGATTTGGAGCTTG
ACCTCCTTGCAAAAACAGCAAAAAGAGCGGGTGAAGATATAACTTTAACGGCAAAAGAGTTTTCACTTTTAGAATATTTA
ATTAAAAACCAAAATAAAGTTTTATCAGAAACAGTATTAGCTTCAATGCTTAATAATATGGATGAATCAAATATTAGTAA
TCTTGTAAATGTCTATATTTATAGACTAAGAAATAAAATAGATAAACCTTATGAAAAAAAACTCATAAAAACAATTAGAG
GATTAGGATTTAAAATAGATGCTCAATAA

Protein sequence :
MKILIIEDDVKIVNFLKKGLEEESYSIDYSHNGEEGLYLASVNSYDLILLDIMLPLLDGIEVCKKLRAEKINTPIIMLTA
KDSIEDTIKGLDIGANDYLPKPFSFSELLARIRVQLRAKDSTQTTLKIADLELDLLAKTAKRAGEDITLTAKEFSLLEYL
IKNQNKVLSETVLASMLNNMDESNISNLVNVYIYRLRNKIDKPYEKKLIKTIRGLGFKIDAQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 1e-40 48
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 4e-40 47

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Arnit_3130 YP_003657282.1 winged helix family two component transcriptional regulator BAC0638 Protein 7e-34 47
Arnit_3130 YP_003657282.1 winged helix family two component transcriptional regulator BAC0083 Protein 4e-40 46
Arnit_3130 YP_003657282.1 winged helix family two component transcriptional regulator BAC0347 Protein 5e-42 45
Arnit_3130 YP_003657282.1 winged helix family two component transcriptional regulator BAC0308 Protein 1e-35 45
Arnit_3130 YP_003657282.1 winged helix family two component transcriptional regulator BAC0197 Protein 9e-40 45
Arnit_3130 YP_003657282.1 winged helix family two component transcriptional regulator BAC0125 Protein 1e-40 44
Arnit_3130 YP_003657282.1 winged helix family two component transcriptional regulator BAC0111 Protein 9e-42 44
Arnit_3130 YP_003657282.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 1e-24 43
Arnit_3130 YP_003657282.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 4e-26 42
Arnit_3130 YP_003657282.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 4e-26 42
Arnit_3130 YP_003657282.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 4e-26 42
Arnit_3130 YP_003657282.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 4e-26 42
Arnit_3130 YP_003657282.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 4e-26 42
Arnit_3130 YP_003657282.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 4e-26 42
Arnit_3130 YP_003657282.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 4e-26 42
Arnit_3130 YP_003657282.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 4e-26 42
Arnit_3130 YP_003657282.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 2e-20 41
Arnit_3130 YP_003657282.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 8e-24 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Arnit_3130 YP_003657282.1 winged helix family two component transcriptional regulator VFG0596 Protein 4e-41 48