Gene Information

Name : Srot_3063 (Srot_3063)
Accession : YP_003660318.1
Strain : Segniliparus rotundus DSM 44985
Genome accession: NC_014168
Putative virulence/resistance : Virulence
Product : transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 3147568 - 3148284 bp
Length : 717 bp
Strand : +
Note : KEGG: mva:Mvan_5009 two component transcriptional regulator; PFAM: response regulator receiver; transcriptional regulator domain protein; SMART: response regulator receiver

DNA sequence :
ATGGAGACTAGTGCTGGTTCCCCAACCGTGCTCGTGGTGGACGACGACCCAGACGTGCTTTCTTCGCTGCAACGCGGGCT
GCGCCTCTCCGGCTTCTCAGTGGTCACCGCCGACAATGGCGCCGCCGCCCTCTCCGCAGTGCACCAGCAGCACCCGGACG
CCTTGATCTTGGACATGAACATGCCCGGCCTCGACGGGGTGAGCGTGGTGACGGCGCTGCGGGCGATGGGCGACGACATC
CCGATCTGCGTGCTTTCCGCCCGCAGCTCGGTCGGGGACCGGATCGAAGGGCTCGAAGCCGGGGCCGACGACTACCTCAC
GAAGCCGTTCGTGCTCGGCGAGCTCATCGCGCGCGTCAAAGCCTTGCTGCGCAGGCCTTCCACGACGAGCCGCGCCGCCC
CGACCGTCGAGTACGGGGTCATCCATGTGGACTACCTGGGGGTGGACATCCCCGGCAGGCGGGTGACGGTGGACGACGAG
TCGATCGAGCTGACCAAACGCGAGTTCGAGCTGCTCGCCGCGCTCGCCGAGAACACCGGCGTGGTGCTCTCGCGCACCGA
ACTGCTCGAGAGGGTGTGGGGCTACGACTTCGCGGCGGACACGAACGTCGTCGACGTGTTCGTCGGCTATTTGCGCAAGA
AACTCGAACTCAAAGGCAGGCACCGGCTCATCCACACGGTGCGCGGCTACGGCTTCGTGCTCCGGGCCGGTCAGTAA

Protein sequence :
METSAGSPTVLVVDDDPDVLSSLQRGLRLSGFSVVTADNGAAALSAVHQQHPDALILDMNMPGLDGVSVVTALRAMGDDI
PICVLSARSSVGDRIEGLEAGADDYLTKPFVLGELIARVKALLRRPSTTSRAAPTVEYGVIHVDYLGVDIPGRRVTVDDE
SIELTKREFELLAALAENTGVVLSRTELLERVWGYDFAADTNVVDVFVGYLRKKLELKGRHRLIHTVRGYGFVLRAGQ

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-28 41
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 2e-28 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Srot_3063 YP_003660318.1 transcriptional regulator HE999704.1.gene1528. Protein 3e-32 45
Srot_3063 YP_003660318.1 transcriptional regulator NC_012469.1.7685629. Protein 1e-28 44
Srot_3063 YP_003660318.1 transcriptional regulator BAC0083 Protein 1e-31 43
Srot_3063 YP_003660318.1 transcriptional regulator BAC0638 Protein 4e-27 43
Srot_3063 YP_003660318.1 transcriptional regulator BAC0125 Protein 7e-30 42
Srot_3063 YP_003660318.1 transcriptional regulator NC_002952.2859905.p0 Protein 3e-30 42
Srot_3063 YP_003660318.1 transcriptional regulator NC_002951.3237708.p0 Protein 5e-30 42
Srot_3063 YP_003660318.1 transcriptional regulator NC_003923.1003749.p0 Protein 4e-30 42
Srot_3063 YP_003660318.1 transcriptional regulator NC_002758.1121668.p0 Protein 5e-30 42
Srot_3063 YP_003660318.1 transcriptional regulator NC_007622.3794472.p0 Protein 3e-30 42
Srot_3063 YP_003660318.1 transcriptional regulator NC_009641.5332272.p0 Protein 5e-30 42
Srot_3063 YP_003660318.1 transcriptional regulator NC_013450.8614421.p0 Protein 5e-30 42
Srot_3063 YP_003660318.1 transcriptional regulator NC_007793.3914279.p0 Protein 5e-30 42
Srot_3063 YP_003660318.1 transcriptional regulator NC_002745.1124361.p0 Protein 5e-30 42
Srot_3063 YP_003660318.1 transcriptional regulator NC_009782.5559369.p0 Protein 5e-30 42
Srot_3063 YP_003660318.1 transcriptional regulator BAC0308 Protein 5e-29 42
Srot_3063 YP_003660318.1 transcriptional regulator NC_012469.1.7686381. Protein 1e-28 41
Srot_3063 YP_003660318.1 transcriptional regulator BAC0111 Protein 1e-27 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Srot_3063 YP_003660318.1 transcriptional regulator VFG1389 Protein 2e-62 67
Srot_3063 YP_003660318.1 transcriptional regulator VFG1390 Protein 8e-44 49
Srot_3063 YP_003660318.1 transcriptional regulator VFG1386 Protein 8e-38 43
Srot_3063 YP_003660318.1 transcriptional regulator VFG0596 Protein 7e-29 41