Gene Information

Name : GC56T3_1345 (GC56T3_1345)
Accession : YP_003670948.1
Strain : Geobacillus sp. C56-T3
Genome accession: NC_014206
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 1390063 - 1390737 bp
Length : 675 bp
Strand : +
Note : KEGG: gyc:GYMC61_0523 two component transcriptional regulator, winged helix family; PFAM: response regulator receiver; transcriptional regulator; SMART: response regulator receiver

DNA sequence :
ATGAACGGACGTATTTTATTGATTGAAGATGAAGCCGGGCTCGCCCGGTTTTTGGAGCTTGACTTAAAGCACGAAGGCTT
TGACGTGCATGTATGCGCCGATGGACGCGAAGGGCTCGAGCTCGCTCTTTCGGAGCAGTGGGATCTCATTTTGCTTGATG
TGATGCTGCCTAGTCTCAATGGCATGGAAGTATGCCGCCGCATCCGGGCGGCGAAATCGACGCCGATCATGATGATCACA
GCGCGCGACAGCGTGTTTGACCGCGTCATGGGGCTCGATAACGGGGCCGATGACTACATCGTCAAACCGTTTGCCATTGA
AGAGCTGCTCGCCCGCATCCGCGCCTTGTTCCGCCGCGTTCATCCGGAAGCGAACGCCCAAGTGTTGACGTTTAAAGATT
TAGTCGTTGACGTGCAGGCGCGCACCGTGAAAAAAGGAGACGAATTTATTGAGCTGACGAAGCGGGAATACGACTTGCTC
GTCGCCTTTATGCAAAACATCAATGTCGTCTTGACGCGTGATGCGCTGCTTGACAAAGTGTGGGGATTTGACGCCGAAGT
CGAGACGAACGTCGTCGATGTGTATGTCCGCTACTTGCGGCAAAAGCTTGACGAACACGATAAAGAGCGGTATATCCAAA
CGGTGCGCGGCACGGGATATGTGATGCGGCCATGA

Protein sequence :
MNGRILLIEDEAGLARFLELDLKHEGFDVHVCADGREGLELALSEQWDLILLDVMLPSLNGMEVCRRIRAAKSTPIMMIT
ARDSVFDRVMGLDNGADDYIVKPFAIEELLARIRALFRRVHPEANAQVLTFKDLVVDVQARTVKKGDEFIELTKREYDLL
VAFMQNINVVLTRDALLDKVWGFDAEVETNVVDVYVRYLRQKLDEHDKERYIQTVRGTGYVMRP

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 3e-35 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-34 43
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 9e-36 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 6e-36 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GC56T3_1345 YP_003670948.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 6e-70 66
GC56T3_1345 YP_003670948.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 2e-56 55
GC56T3_1345 YP_003670948.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 2e-56 55
GC56T3_1345 YP_003670948.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 2e-56 55
GC56T3_1345 YP_003670948.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 2e-56 55
GC56T3_1345 YP_003670948.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 2e-56 55
GC56T3_1345 YP_003670948.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 2e-56 55
GC56T3_1345 YP_003670948.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 2e-56 55
GC56T3_1345 YP_003670948.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 2e-56 55
GC56T3_1345 YP_003670948.1 winged helix family two component transcriptional regulator AE015929.1.gene1106. Protein 7e-53 54
GC56T3_1345 YP_003670948.1 winged helix family two component transcriptional regulator BAC0125 Protein 2e-38 44
GC56T3_1345 YP_003670948.1 winged helix family two component transcriptional regulator BAC0308 Protein 3e-38 44
GC56T3_1345 YP_003670948.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 2e-38 44
GC56T3_1345 YP_003670948.1 winged helix family two component transcriptional regulator BAC0197 Protein 5e-36 43
GC56T3_1345 YP_003670948.1 winged helix family two component transcriptional regulator CP001485.1.gene721.p Protein 1e-32 42
GC56T3_1345 YP_003670948.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 3e-40 42
GC56T3_1345 YP_003670948.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 2e-44 42
GC56T3_1345 YP_003670948.1 winged helix family two component transcriptional regulator BAC0083 Protein 1e-38 42
GC56T3_1345 YP_003670948.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 3e-39 41
GC56T3_1345 YP_003670948.1 winged helix family two component transcriptional regulator BAC0111 Protein 2e-37 41
GC56T3_1345 YP_003670948.1 winged helix family two component transcriptional regulator BAC0638 Protein 8e-36 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GC56T3_1345 YP_003670948.1 winged helix family two component transcriptional regulator VFG1390 Protein 2e-47 47
GC56T3_1345 YP_003670948.1 winged helix family two component transcriptional regulator VFG0596 Protein 1e-35 43
GC56T3_1345 YP_003670948.1 winged helix family two component transcriptional regulator VFG1389 Protein 2e-39 43
GC56T3_1345 YP_003670948.1 winged helix family two component transcriptional regulator VFG1563 Protein 5e-36 41
GC56T3_1345 YP_003670948.1 winged helix family two component transcriptional regulator VFG1702 Protein 2e-36 41