Gene Information

Name : GC56T3_0761 (GC56T3_0761)
Accession : YP_003670383.1
Strain : Geobacillus sp. C56-T3
Genome accession: NC_014206
Putative virulence/resistance : Virulence
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 814097 - 814804 bp
Length : 708 bp
Strand : +
Note : KEGG: gyc:GYMC61_0785 two component transcriptional regulator, winged helix family; PFAM: response regulator receiver; transcriptional regulator; SMART: response regulator receiver

DNA sequence :
ATGGGACGAAAAATTTTAGTTGTCGATGACGAACAGCCGATTGTGACTCTGTTGTCGTACAATTTGGAGAAAGCCGGATT
TCACGTCGTGACCGCTCACGATGGCGAAGAGGCGCTCGTGAAAGTAGCGTCCGAGCAGCCGGCGCTCATTATTTTGGACT
TGATGTTGCCGAAGCTTGACGGCGTTGATGTGTGCAAGCGGCTTCGCCAGCAGCAAATCATGACGCCGATTTTAATGTTG
ACGGCTCGCGATGATGAATTTGACAAAGTGCTTGGTCTTGAGCTTGGCGCCGACGACTATATGACAAAGCCGTTCAGCCC
GCGCGAAGTCATTGCACGCGTCAAGGCGATTTTGCGCCGCACGGAGATCGTTCAGCCGGCGGCTGAATCGAGCGAGCGGC
TTGTTGTTGGCGAGCTGGAAATTTTTCCGGAACGCTATGAAGCAACGATCGGCGGCAAGCCGCTTGAGCTGACGCCGAAA
GAGTTTGAGTTGCTCCTTTATTTGGCTCGCCATAAAGGGCGGGTGTTGACGCGCGACCAGCTGCTCAGCGCCGTGTGGAA
CTACGAGTTTGCCGGCGATACACGCATTGTCGACGTCCATATCAGCCACTTGCGCGAGAAGATCGAAACCGATACGAAAA
AACCGATGTACATTAAAACGGTGCGCGGCCTTGGCTATAAATTGGAGGAACCGAAGCGGCATGAATAG

Protein sequence :
MGRKILVVDDEQPIVTLLSYNLEKAGFHVVTAHDGEEALVKVASEQPALIILDLMLPKLDGVDVCKRLRQQQIMTPILML
TARDDEFDKVLGLELGADDYMTKPFSPREVIARVKAILRRTEIVQPAAESSERLVVGELEIFPERYEATIGGKPLELTPK
EFELLLYLARHKGRVLTRDQLLSAVWNYEFAGDTRIVDVHISHLREKIETDTKKPMYIKTVRGLGYKLEEPKRHE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 2e-41 42
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 3e-41 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GC56T3_0761 YP_003670383.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 4e-76 67
GC56T3_0761 YP_003670383.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 4e-76 67
GC56T3_0761 YP_003670383.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 4e-76 67
GC56T3_0761 YP_003670383.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 4e-76 67
GC56T3_0761 YP_003670383.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 4e-76 67
GC56T3_0761 YP_003670383.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 3e-76 67
GC56T3_0761 YP_003670383.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 4e-76 67
GC56T3_0761 YP_003670383.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 4e-76 67
GC56T3_0761 YP_003670383.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 7e-76 67
GC56T3_0761 YP_003670383.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 5e-76 66
GC56T3_0761 YP_003670383.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 7e-73 62
GC56T3_0761 YP_003670383.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 2e-64 55
GC56T3_0761 YP_003670383.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 4e-57 54
GC56T3_0761 YP_003670383.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 5e-63 53
GC56T3_0761 YP_003670383.1 winged helix family two component transcriptional regulator CP001918.1.gene5135. Protein 5e-33 47
GC56T3_0761 YP_003670383.1 winged helix family two component transcriptional regulator CP001138.1.gene4273. Protein 1e-37 47
GC56T3_0761 YP_003670383.1 winged helix family two component transcriptional regulator NC_002695.1.915041.p Protein 3e-37 47
GC56T3_0761 YP_003670383.1 winged helix family two component transcriptional regulator CP000034.1.gene3834. Protein 3e-37 47
GC56T3_0761 YP_003670383.1 winged helix family two component transcriptional regulator BAC0197 Protein 1e-34 46
GC56T3_0761 YP_003670383.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 6e-42 46
GC56T3_0761 YP_003670383.1 winged helix family two component transcriptional regulator CP004022.1.gene3215. Protein 3e-40 46
GC56T3_0761 YP_003670383.1 winged helix family two component transcriptional regulator BAC0533 Protein 3e-37 46
GC56T3_0761 YP_003670383.1 winged helix family two component transcriptional regulator CP000647.1.gene4257. Protein 3e-37 46
GC56T3_0761 YP_003670383.1 winged helix family two component transcriptional regulator AF155139.2.orf0.gene Protein 7e-44 44
GC56T3_0761 YP_003670383.1 winged helix family two component transcriptional regulator NC_007622.3794948.p0 Protein 6e-42 43
GC56T3_0761 YP_003670383.1 winged helix family two component transcriptional regulator NC_003923.1003417.p0 Protein 6e-42 43
GC56T3_0761 YP_003670383.1 winged helix family two component transcriptional regulator NC_013450.8614146.p0 Protein 6e-42 43
GC56T3_0761 YP_003670383.1 winged helix family two component transcriptional regulator NC_002951.3238224.p0 Protein 6e-42 43
GC56T3_0761 YP_003670383.1 winged helix family two component transcriptional regulator NC_007793.3914065.p0 Protein 6e-42 43
GC56T3_0761 YP_003670383.1 winged helix family two component transcriptional regulator NC_002758.1121390.p0 Protein 6e-42 43
GC56T3_0761 YP_003670383.1 winged helix family two component transcriptional regulator NC_010079.5776364.p0 Protein 6e-42 43
GC56T3_0761 YP_003670383.1 winged helix family two component transcriptional regulator NC_002952.2859858.p0 Protein 6e-42 43
GC56T3_0761 YP_003670383.1 winged helix family two component transcriptional regulator BAC0083 Protein 4e-36 43
GC56T3_0761 YP_003670383.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 3e-42 43
GC56T3_0761 YP_003670383.1 winged helix family two component transcriptional regulator CP001485.1.gene721.p Protein 6e-37 43
GC56T3_0761 YP_003670383.1 winged helix family two component transcriptional regulator BAC0039 Protein 1e-35 43
GC56T3_0761 YP_003670383.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 1e-35 43
GC56T3_0761 YP_003670383.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 1e-35 43
GC56T3_0761 YP_003670383.1 winged helix family two component transcriptional regulator NC_011595.7057856.p0 Protein 2e-37 42
GC56T3_0761 YP_003670383.1 winged helix family two component transcriptional regulator NC_010400.5986590.p0 Protein 1e-37 42
GC56T3_0761 YP_003670383.1 winged helix family two component transcriptional regulator NC_010410.6002989.p0 Protein 2e-37 42
GC56T3_0761 YP_003670383.1 winged helix family two component transcriptional regulator AF162694.1.orf4.gene Protein 2e-38 42
GC56T3_0761 YP_003670383.1 winged helix family two component transcriptional regulator DQ212986.1.gene4.p01 Protein 2e-42 42
GC56T3_0761 YP_003670383.1 winged helix family two component transcriptional regulator NC_005054.2598277.p0 Protein 5e-41 42
GC56T3_0761 YP_003670383.1 winged helix family two component transcriptional regulator NC_014475.1.orf0.gen Protein 5e-41 42
GC56T3_0761 YP_003670383.1 winged helix family two component transcriptional regulator AM180355.1.gene1830. Protein 1e-41 42
GC56T3_0761 YP_003670383.1 winged helix family two component transcriptional regulator EU250284.1.orf4.gene Protein 2e-41 42
GC56T3_0761 YP_003670383.1 winged helix family two component transcriptional regulator BAC0596 Protein 2e-35 42
GC56T3_0761 YP_003670383.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 2e-35 42
GC56T3_0761 YP_003670383.1 winged helix family two component transcriptional regulator CP000675.2.gene1535. Protein 9e-39 41
GC56T3_0761 YP_003670383.1 winged helix family two component transcriptional regulator BAC0125 Protein 1e-32 41
GC56T3_0761 YP_003670383.1 winged helix family two component transcriptional regulator BAC0111 Protein 9e-33 41
GC56T3_0761 YP_003670383.1 winged helix family two component transcriptional regulator HE999704.1.gene1528. Protein 1e-32 41
GC56T3_0761 YP_003670383.1 winged helix family two component transcriptional regulator BAC0308 Protein 9e-32 41
GC56T3_0761 YP_003670383.1 winged helix family two component transcriptional regulator CP000034.1.gene3671. Protein 5e-38 41
GC56T3_0761 YP_003670383.1 winged helix family two component transcriptional regulator CP001918.1.gene3444. Protein 1e-34 41
GC56T3_0761 YP_003670383.1 winged helix family two component transcriptional regulator CP000647.1.gene2531. Protein 2e-35 41
GC56T3_0761 YP_003670383.1 winged helix family two component transcriptional regulator NC_008702.1.4607594. Protein 2e-34 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
GC56T3_0761 YP_003670383.1 winged helix family two component transcriptional regulator VFG1389 Protein 4e-37 48
GC56T3_0761 YP_003670383.1 winged helix family two component transcriptional regulator VFG1386 Protein 7e-43 45
GC56T3_0761 YP_003670383.1 winged helix family two component transcriptional regulator VFG1390 Protein 2e-39 43
GC56T3_0761 YP_003670383.1 winged helix family two component transcriptional regulator VFG1563 Protein 1e-41 42
GC56T3_0761 YP_003670383.1 winged helix family two component transcriptional regulator VFG1702 Protein 1e-41 42