Gene Information

Name : Ndas_4549 (Ndas_4549)
Accession : YP_003682442.1
Strain :
Genome accession: NC_014210
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 5391304 - 5391969 bp
Length : 666 bp
Strand : +
Note : COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR001789:IPR001867:IPR011006:IPR011991; KEGG: svi:Svir_31270 response regulator with CheY-like receiver domain protein and winged-

DNA sequence :
TTGGCGATTCTGGTGGTGGAGGACGAGGAGGGGATCGTCTCCTTCGTGCGGCGCGGGCTGGAGACGGCCGGTTACCAGGT
GCTCACCGCAGCCGACGGGATCGACGGGCTGACGATGGCCCTGTCGTCGGACGTCGATCTCGTCGTCTTGGACCTGGGGC
TGCCGGGGATCCCGGGTGAGGAGGTGCTGCGGCGGCTGCGCGCGCGCCGCCCCTCGGTGCCGGTGATCGTGCTCACCGCC
AAGGACGCCGTGAGCGACCGGGTCGCCAACCTCGACGCCGGGGCCGACGACTACATGGTCAAGCCGTTCAGCGTGAGCGA
GCTGCTGGCCCGCGTGCGGGCCCGGCTGCGCGGCGGCGGCCAGGAACGCGGCGACGTGCTGGCCGCGGGCGGTGTGGTGC
TCGACCTCGGGGCGCGCACCGCCTCGGTGGAGGGTCGCACCGTCAACCTGTCGGCACGTGAGTTCGCGCTGCTGGAGGTG
CTCATCCGCCATCCGACGCAGGTCTTCTCCCGGCCCCAGCTGCTGGACCGGGTCTGGGGCTACGACTTCGACGGCGCCTC
CAACGTGGTGGAGGTCTACGTCAGCCAGCTGCGCCGCAAGCTCGGCAGCGAGCGCATCCAGACGGTCCGCGGCGCCGGGT
ACCGGCTCGGGGACGGCGCACGGTGA

Protein sequence :
MAILVVEDEEGIVSFVRRGLETAGYQVLTAADGIDGLTMALSSDVDLVVLDLGLPGIPGEEVLRRLRARRPSVPVIVLTA
KDAVSDRVANLDAGADDYMVKPFSVSELLARVRARLRGGGQERGDVLAAGGVVLDLGARTASVEGRTVNLSAREFALLEV
LIRHPTQVFSRPQLLDRVWGYDFDGASNVVEVYVSQLRRKLGSERIQTVRGAGYRLGDGAR

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 2e-29 45
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 1e-28 43

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Ndas_4549 YP_003682442.1 two component transcriptional regulator AE015929.1.gene1106. Protein 2e-27 45
Ndas_4549 YP_003682442.1 two component transcriptional regulator NC_010079.5776364.p0 Protein 1e-30 44
Ndas_4549 YP_003682442.1 two component transcriptional regulator NC_002952.2859858.p0 Protein 1e-30 44
Ndas_4549 YP_003682442.1 two component transcriptional regulator NC_007622.3794948.p0 Protein 1e-30 44
Ndas_4549 YP_003682442.1 two component transcriptional regulator NC_003923.1003417.p0 Protein 1e-30 44
Ndas_4549 YP_003682442.1 two component transcriptional regulator NC_013450.8614146.p0 Protein 1e-30 44
Ndas_4549 YP_003682442.1 two component transcriptional regulator NC_002951.3238224.p0 Protein 1e-30 44
Ndas_4549 YP_003682442.1 two component transcriptional regulator NC_007793.3914065.p0 Protein 1e-30 44
Ndas_4549 YP_003682442.1 two component transcriptional regulator NC_002758.1121390.p0 Protein 1e-30 44
Ndas_4549 YP_003682442.1 two component transcriptional regulator BAC0083 Protein 7e-30 44
Ndas_4549 YP_003682442.1 two component transcriptional regulator BAC0197 Protein 4e-28 44
Ndas_4549 YP_003682442.1 two component transcriptional regulator BAC0638 Protein 4e-22 43
Ndas_4549 YP_003682442.1 two component transcriptional regulator NC_002516.2.879194.p Protein 1e-22 41
Ndas_4549 YP_003682442.1 two component transcriptional regulator HE999704.1.gene2815. Protein 5e-31 41
Ndas_4549 YP_003682442.1 two component transcriptional regulator AE000516.2.gene3505. Protein 6e-28 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Ndas_4549 YP_003682442.1 two component transcriptional regulator VFG1389 Protein 2e-33 47
Ndas_4549 YP_003682442.1 two component transcriptional regulator VFG0596 Protein 9e-30 45
Ndas_4549 YP_003682442.1 two component transcriptional regulator VFG1390 Protein 1e-32 42
Ndas_4549 YP_003682442.1 two component transcriptional regulator VFG1386 Protein 3e-29 42