Gene Information

Name : Ndas_4793 (Ndas_4793)
Accession : YP_003682683.1
Strain :
Genome accession: NC_014210
Putative virulence/resistance : Virulence
Product : two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 5680857 - 5681516 bp
Length : 660 bp
Strand : +
Note : COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterProIPR001789:IPR011991:IPR011006:IPR001867:IPR 005829; KEGG: tfu:Tfu_1330 response regulator receiver; PFAM: response regulator receive

DNA sequence :
GTGAGTCGCATCCTCATCGTCGAGGACGAGGAGCGGATCGCCTCGTTCGTCCGCAAGGGCCTGGACGCCAGCGGGTTCAC
CACCACCGTGGTGGGCACGGGGGCGGAGGCCGTGGACTACGCGGTGACCGGCGGGTTCGACCTGATGCTGCTGGACCTGG
GCCTGCCGGACACCGACGGGTTCGACGTGCTGCGGCGCGTGCGCTCGCTGGGCGTGGACATCCCCGTGGTCATCCTGACC
GCGCGCGACGGCGTGCGGGACACGGTGACCGGCCTGGAGATCGGGGCCGACGACTACGTCACCAAACCGTTCCGGTTCGA
GGAACTGCTGGCCCGGGTGCGGCTGCGGATGCGCAACGAGCGTCCGACCGAGCTGACGGTGCTGCGCGCGGGCGGCCTGG
CCCTGGACCTGCGCACGCGGCGGGTGGCGGTGGAGGGGACGTCCGTGGACCTGACCGCGCGCGAGTTCTCCCTGCTGGAG
CTGCTGATGCGGCACCCGGGCCAGGTGCTCACCAGGCAGCAGATGCTGTCGCACGTGTGGGGCTACGACTACGACCCCGG
GTCGAACGTGGTGGACGTGTTCGTGCGGGCGCTGCGCCGCAAGGTGGGCGCGGAGCGGATCGTGACCGTGCGCGGGATGG
GCTACCGGTTGACCGGGTGA

Protein sequence :
MSRILIVEDEERIASFVRKGLDASGFTTTVVGTGAEAVDYAVTGGFDLMLLDLGLPDTDGFDVLRRVRSLGVDIPVVILT
ARDGVRDTVTGLEIGADDYVTKPFRFEELLARVRLRMRNERPTELTVLRAGGLALDLRTRRVAVEGTSVDLTAREFSLLE
LLMRHPGQVLTRQQMLSHVWGYDYDPGSNVVDVFVRALRRKVGAERIVTVRGMGYRLTG

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
copR NP_460069.2 transcriptional regulatory protein YedW Not tested SPI-5 Protein 5e-31 43
copR AAC33719.1 regulatory protein CopR Not tested SPI-5 Protein 3e-30 42

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Ndas_4793 YP_003682683.1 two component transcriptional regulator BAC0197 Protein 2e-33 49
Ndas_4793 YP_003682683.1 two component transcriptional regulator BAC0125 Protein 1e-33 46
Ndas_4793 YP_003682683.1 two component transcriptional regulator BAC0083 Protein 2e-35 45
Ndas_4793 YP_003682683.1 two component transcriptional regulator BAC0638 Protein 7e-28 45
Ndas_4793 YP_003682683.1 two component transcriptional regulator HE999704.1.gene1528. Protein 3e-24 43
Ndas_4793 YP_003682683.1 two component transcriptional regulator BAC0347 Protein 4e-27 43
Ndas_4793 YP_003682683.1 two component transcriptional regulator BAC0308 Protein 9e-31 43
Ndas_4793 YP_003682683.1 two component transcriptional regulator AE015929.1.gene1106. Protein 5e-25 41
Ndas_4793 YP_003682683.1 two component transcriptional regulator BAC0111 Protein 3e-30 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Ndas_4793 YP_003682683.1 two component transcriptional regulator VFG0596 Protein 2e-31 43
Ndas_4793 YP_003682683.1 two component transcriptional regulator VFG1390 Protein 9e-31 41