Gene Information

Name : Mesil_0142 (Mesil_0142)
Accession : YP_003683595.1
Strain : Meiothermus silvanus DSM 9946
Genome accession: NC_014212
Putative virulence/resistance : Resistance
Product : winged helix family two component transcriptional regulator
Function : -
COG functional category : T : Signal transduction mechanisms
COG ID : COG0745
EC number : -
Position : 148169 - 148834 bp
Length : 666 bp
Strand : -
Note : COGs: COG0745 Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain; InterPro IPR011006:IPR001789:IPR001867; KEGG: ttj:TTHA1722 putative response regulator; PFAM: response regulator receiver; transcriptional r

DNA sequence :
GTGGCTCGAGTGCTGCTGGTAGATGATGACCCGGCGATCCGCGAGGTACTTAGCGCTTACCTGCGCCAAGAAGGCTACGA
GGTGGTAGAGGCCGCAGACGGGCTAGAAGCGCTGGGAAAGATTCCCCAGGCCAGCCTGGTAGTGCTCGACCTGATGCTAC
CCCGGCTTTCGGGCTGGGAGGTGGCCCGCGAACTCCGGCGGGACTACCCCGAGCTGCCCGTTTTGATGCTCACCGCCAAA
GGGGAAGAGGAAGAGCGCATCCGAGGGCTCGACCTGGGGGCAGACGACTACGTGACCAAGCCCTTCAGCCCGCGCGAGGT
GGTAGCTCGGGTGCGGGCTTTGCTGCGCCGCAGCGGGCTTAAGGCCGAACTGGCCTTCGGCGAGTTGGTGATCCGACCCC
GCGAGCGTGAAGCCTACCTGGCCGGAGAACCCCTGGCGCTCTCGAAGCTCGAGTTCGACCTACTCCTGACCCTAGCCCAG
CACCCCAGGTTGGTGTGGAGCCGCGAGCGCCTCCTGGAGCGGGTCTGGGGTACCGACTTCCCCGGGGTGGATCGGGTAGT
GGATGTGCATATCGCCGGGCTGCGCAAAAAGCTGGGCGAGGACGGCGACAACCCCCGCTACATCGAGACGGTGCGCGGGG
TGGGCTACCGCTTCCAGGAGGAGTGA

Protein sequence :
MARVLLVDDDPAIREVLSAYLRQEGYEVVEAADGLEALGKIPQASLVVLDLMLPRLSGWEVARELRRDYPELPVLMLTAK
GEEEERIRGLDLGADDYVTKPFSPREVVARVRALLRRSGLKAELAFGELVIRPREREAYLAGEPLALSKLEFDLLLTLAQ
HPRLVWSRERLLERVWGTDFPGVDRVVDVHIAGLRKKLGEDGDNPRYIETVRGVGYRFQEE

• Homologs from PAI DB

GeneGenBank Accn Product Virulance or Resistance PAI or REI Alignment Type E-val Identity
vanRB NP_815956.1 DNA-binding response regulator VanRB Not tested Not named Protein 1e-29 44
vanRB YP_008394254.1 DNA-binding response regulator VanRB Not tested Not named Protein 3e-30 43
unnamed CAD42044.1 hypothetical protein Not tested PAI II 536 Protein 1e-28 41
c3565 NP_755440.1 response regulator Not tested PAI I CFT073 Protein 1e-28 41

• Homologs from CARD and BacMet (resistance genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mesil_0142 YP_003683595.1 winged helix family two component transcriptional regulator HE999704.1.gene2815. Protein 3e-40 47
Mesil_0142 YP_003683595.1 winged helix family two component transcriptional regulator NC_002952.2859905.p0 Protein 8e-38 46
Mesil_0142 YP_003683595.1 winged helix family two component transcriptional regulator NC_007622.3794472.p0 Protein 8e-38 46
Mesil_0142 YP_003683595.1 winged helix family two component transcriptional regulator NC_002745.1124361.p0 Protein 7e-38 46
Mesil_0142 YP_003683595.1 winged helix family two component transcriptional regulator NC_009782.5559369.p0 Protein 7e-38 46
Mesil_0142 YP_003683595.1 winged helix family two component transcriptional regulator NC_002951.3237708.p0 Protein 7e-38 46
Mesil_0142 YP_003683595.1 winged helix family two component transcriptional regulator NC_002758.1121668.p0 Protein 7e-38 46
Mesil_0142 YP_003683595.1 winged helix family two component transcriptional regulator NC_009641.5332272.p0 Protein 7e-38 46
Mesil_0142 YP_003683595.1 winged helix family two component transcriptional regulator NC_013450.8614421.p0 Protein 7e-38 46
Mesil_0142 YP_003683595.1 winged helix family two component transcriptional regulator NC_003923.1003749.p0 Protein 9e-38 46
Mesil_0142 YP_003683595.1 winged helix family two component transcriptional regulator NC_007793.3914279.p0 Protein 7e-38 46
Mesil_0142 YP_003683595.1 winged helix family two component transcriptional regulator AE000516.2.gene3505. Protein 3e-36 45
Mesil_0142 YP_003683595.1 winged helix family two component transcriptional regulator AE016830.1.gene2255. Protein 4e-30 44
Mesil_0142 YP_003683595.1 winged helix family two component transcriptional regulator U35369.1.gene1.p01 Protein 4e-30 44
Mesil_0142 YP_003683595.1 winged helix family two component transcriptional regulator NC_012469.1.7685629. Protein 6e-34 44
Mesil_0142 YP_003683595.1 winged helix family two component transcriptional regulator AF310956.2.orf0.gene Protein 1e-30 43
Mesil_0142 YP_003683595.1 winged helix family two component transcriptional regulator AE016830.1.gene1681. Protein 7e-39 43
Mesil_0142 YP_003683595.1 winged helix family two component transcriptional regulator NC_012469.1.7686381. Protein 4e-35 42
Mesil_0142 YP_003683595.1 winged helix family two component transcriptional regulator FJ349556.1.orf0.gene Protein 2e-39 42
Mesil_0142 YP_003683595.1 winged helix family two component transcriptional regulator CP001485.1.gene721.p Protein 2e-30 42
Mesil_0142 YP_003683595.1 winged helix family two component transcriptional regulator CP004022.1.gene3215. Protein 9e-29 41
Mesil_0142 YP_003683595.1 winged helix family two component transcriptional regulator CP001918.1.gene3444. Protein 2e-28 41
Mesil_0142 YP_003683595.1 winged helix family two component transcriptional regulator BAC0596 Protein 1e-28 41
Mesil_0142 YP_003683595.1 winged helix family two component transcriptional regulator BAC0039 Protein 1e-28 41
Mesil_0142 YP_003683595.1 winged helix family two component transcriptional regulator NC_002695.1.916589.p Protein 6e-29 41
Mesil_0142 YP_003683595.1 winged helix family two component transcriptional regulator CP000647.1.gene2531. Protein 6e-28 41
Mesil_0142 YP_003683595.1 winged helix family two component transcriptional regulator CP001138.1.gene2239. Protein 1e-28 41
Mesil_0142 YP_003683595.1 winged helix family two component transcriptional regulator CP000034.1.gene2186. Protein 1e-28 41
Mesil_0142 YP_003683595.1 winged helix family two component transcriptional regulator CP004022.1.gene1676. Protein 5e-25 41

• Homologs from VFDB (virulence genes)

GeneGenBank Accn Product ID of source DB Alignment Type E-val Identity
Mesil_0142 YP_003683595.1 winged helix family two component transcriptional regulator VFG1390 Protein 4e-34 43
Mesil_0142 YP_003683595.1 winged helix family two component transcriptional regulator VFG1563 Protein 5e-29 41
Mesil_0142 YP_003683595.1 winged helix family two component transcriptional regulator VFG1702 Protein 4e-29 41
Mesil_0142 YP_003683595.1 winged helix family two component transcriptional regulator VFG1386 Protein 3e-27 41
Mesil_0142 YP_003683595.1 winged helix family two component transcriptional regulator VFG1389 Protein 2e-25 41